FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79B1_SINAL (Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.641e-20
Identity = 69/243 (28.40%), Postives = 114/243 (46.91%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDD-----PLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENIN-------VAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N + ++MF  R  SQ+      P    ++ +      L  +F +   D++PIL    L G+ KI ++     +  + D  ++ R K      M  E  K  I+  LD     +  E N L   + I        +AA +    ++EW +AE+VN PEI +K   E+D V+G    + E D  KL Y++A+++E  RL       +PH+ L DA + GY +P  S++L++ + L   P  W  P
Sbjct:  209 NAIKKLMFGTRTFSQNTAPNGGPTAEDIEHMEAMFEALGFTFSFCISDYLPILTGLDLNGHEKIMRD-SSAIMDKYHDPIIDARIK------MWREGKKTQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADP 444          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.641e-20
Identity = 67/234 (28.63%), Postives = 116/234 (49.57%), Query Frame = 2
Query:    8 MYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE-INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            M N + ++M  +R         N  K +  E   +A  F  N GDFIP L    L+G  K  K + ++   L    F +E K     +    + L   +++     ++GE ++  N+  ++ N+  A  +T+  +IEW +AE++ +P I KK + E+D V+G   ++ E D   LPYL+A+ KET R   + PL +P ++     + GY +P  +++ VN W +   P  W+ P
Sbjct:  180 MANMIGQVMLSKRVFVDKGVEVNEFKDMVVELMTIAGYF--NIGDFIPCLAWMDLQGIEKRMKRLHKKFDALLTKMF-DEHKATTYERKGKPDFLDVVMEN--GDNSEGERLSTTNIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQAEMDQVIGRNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPQVWENP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BH_ARATH (Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.641e-20
Identity = 70/240 (29.17%), Postives = 115/240 (47.92%), Query Frame = 2
Query:   20 MYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPI-----LRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG------EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++R+ F + F   +    +++  L  E      SF  +  DF PI     L  ++ G  K   +V   +L     + +++      +K       K  +D +LD   K        +  D++  ++ NI +A I+T   ++ W + EL  +PEI KK++ E+   LG   + IT+ D  K+P+L  VIKET RL    PLL+P   +   K+ GYD+P + +ILVNAW +   P  W  P
Sbjct:  181 LFRVAFGQSFHESEFTDTDKIDELVFETETAQGSFTCS--DFFPIAGLGWLVDWISGQHKRLNDVF-LKLDALLQHVIDDHSNPGRSKDH-----KDIVDVMLDVMHKQGKDDSLRLTIDHIKGLLTNIIIAGIDTGALTMIWTMTELARNPEIMKKVQGEIRDRLGNNRERITKEDLDKVPFLNLVIKETFRLHPVAPLLLPRETMAHVKVQGYDIPPKRRILVNAWAIGRDPKLWTDP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.450e-20
Identity = 62/200 (31.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query:  110 LAQSFEYNYGDFIPILRPF-----LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            +  S + N  D  P+L+        RG  +   +V    L +F D  +EER +    +    + L   +  + D     E N  N+  +  ++ VA  +TT  +IEW + EL+  P I  K + EL+ V+G G  + E D  +LPYL  ++KE LRL    PLL+P   +   +L GY +PA + + VNAW +   P  W
Sbjct:  207 MVDSAKTNLVDVFPVLKKIDPQGIKRGMARHFSKV----LGIF-DQLIEERMRTGRFEQ--GDVLDVCLKMMQD--NPNEFNHTNIKALFLDLFVAGTDTTSITIEWAMTELLRKPHIMSKAKEELEKVIGKGSIVKEDDVLRLPYLSCIVKEVLRLHPPSPLLLPRKVVTQVELSGYTIPAGTLVFVNAWAIGRDPTVW 397          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AJ_ARATH (Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.450e-20
Identity = 66/225 (29.33%), Postives = 118/225 (52.44%), Query Frame = 2
Query:   26 RIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF--LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            R    R++ S++D +       N  R+  A   E+  G++IP L     +RG     +EV ++R   F +  V+E +        + ++    +D +L  Q+    ++  +  I+ ++ +A   T+L  +EW + EL+ +P++ KKL+ E+ +    G  +TE +  K+ YLQAVIKE LRLR   PL+VP +   D  L GY++PA +++++NAW +      W
Sbjct:  188 RAALGRKYSSKEDGI----DVENIVRAFSALVGEFPIGEYIPSLSWIDKIRGQDHKMEEV-DKRFDEFLERVVKEHE------DANKDTRSDLVDTLLTIQS----DKSALKLIIWDMFLAGTATSLSFLEWAMTELMRNPKVMKKLQEEIRSSSRQGLFVTEKEAEKMDYLQAVIKEALRLRPPAPLMVPRVFSEDVTLKGYNIPAGTQVIINAWAIQRDTTTW 397          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C83B1_ARATH (Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.506e-20
Identity = 47/121 (38.84%), Postives = 75/121 (61.98%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            +   +NV  ++ +I V   +T    + W +  L+ +PE  KK ++E+ +V+G    ++E D   LPYL+AVIKE+LRL   IP+L+    + DAK+GGYD+PA++ I VNAW ++   A W
Sbjct:  283 KFTHENVKAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRSVIGDKGYVSEEDIPNLPYLKAVIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAW 403          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79B2_ARATH (Tryptophan N-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.506e-20
Identity = 64/237 (27.00%), Postives = 113/237 (47.68%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDD-----PLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKL-ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N + ++MF  R  S++      P    ++ +      L  +F +   D++P+L    L G+ KI +E     +  + D  ++ER K+    K    E        I D Q    +  D +   ++ + +AA +    ++EW +AE+VN PEI +K   E+D V+G    + E D  KL Y++A+++E  RL       +PH+ L D  + GY +P  S++L++ + L   P  W  P
Sbjct:  208 NAIKKLMFGTRTFSKNTAPDGGPTVEDVEHMEAMFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRE-SSAIMDKYHDPIIDERIKMWREGKRTQIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADP 443          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_MOUSE (Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.884e-20
Identity = 69/232 (29.74%), Postives = 102/232 (43.97%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK---------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F + F  + + + N    +N  +  +      N  DF P+LR      LK        R + F D FV   +K  + +    +  K +I  I  A  K         G I E+ ++ IV +I  A  +T   +I W I  LV  P +Q+K+  ELDTV+G   Q    D  +LPYL+A I E  R    +P  +PH    D  L G+ +P E  I +N W + +    WK P
Sbjct:  204 FGKNFPRKSEEMLN---IVNNSKDFVENVTSGNAVDFFPVLRYLPNPALK--------RFKTFNDNFVLFLQK--TVQEHYQDFNKNSIQDITSALFKHSENYKDNGGLIPEEKIVNIVNDIFGAGFDTVTTAITWSILLLVTWPNVQRKIHEELDTVVGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKERCIYINQWQVNHDEKQWKDP 422          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71A6_NEPRA (Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.884e-20
Identity = 46/139 (33.09%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  299 IDHILDAQTKGE-----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKK 700
            +D +L  Q + E     +++  +  ++ ++ +A  +TT+ ++EW ++EL+ +P   K L+ E+  V G   +I E D  K+PYL+AV+KE+LRL   +PLLVP  +  D K+ GYDV + +++L+N W +    + W++
Sbjct:  279 VDLLLQFQRENERSSSPVDDLTIKAVILDMFLAGTDTTVTALEWALSELIKNPRAMKILQKEVRGVAGSKGEIEESDLEKMPYLKAVMKESLRLHAPVPLLVPRESTRDTKVLGYDVASGTRVLINCWAIGRDSSVWEE 417          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_RAT (Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 7.685e-20
Identity = 69/232 (29.74%), Postives = 103/232 (44.40%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK---------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F + F  + + + N +K+       +      N  DF P+LR      LK        R + F D FV   +K  + +    +  K +I  I  A  K         G I ++ ++ IV +I  A  ET   +I W I  LV  P++Q+K+  ELDTV+G   Q    D  +LPYL+A I E  R    +P  +PH    D  L G+ +P E  I +N W + +    WK P
Sbjct:  204 FGKNFPRKSEEMLNLVKSSKDFVENVTSG---NAVDFFPVLRYLPNPALK--------RFKNFNDNFVLFLQK--TVQEHYQDFNKNSIQDITGALFKHSENYKDNGGLIPQEKIVNIVNDIFGAGFETVTTAIFWSILLLVTEPKVQRKIHEELDTVIGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKECCIFINQWQVNHDEKQWKDP 422          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C79B1_SINAL2.641e-2028.40Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE... [more]
C75A1_PETHY2.641e-2028.63Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
C71BH_ARATH2.641e-2029.17Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=C... [more]
C76B1_HELTU3.450e-2031.007-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C71AJ_ARATH3.450e-2029.33Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=C... [more]
C83B1_ARATH4.506e-2038.84Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CY... [more]
C79B2_ARATH4.506e-2027.00Tryptophan N-hydroxylase 1 OS=Arabidopsis thaliana... [more]
CP1A2_MOUSE5.884e-2029.74Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1... [more]
C71A6_NEPRA5.884e-2033.09Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa... [more]
CP1A2_RAT7.685e-2029.74Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top