FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_CALJA (Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3)

HSP 1 Score: 96.6709 bits (239), Expect = 1.311e-19
Identity = 64/225 (28.44%), Postives = 103/225 (45.78%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQ-TKGE-INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F + F    D + + +K        +  +   N  DF PILR      L+  K   +R L+  ++   E  +   S K+   +       H        G+ I ++ ++ +V +I  A  +T   +I W +  LV  PEIQ+K++ ELDTV+G G +    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P E  + +N W + + P  W  P
Sbjct:  205 FGQHFPESSDEMLSLMK---NSHVFVENATSGNPVDFFPILRYLPNPALQRFKAFNQRFLRFLRETVQEHYQD--SDKNSVQDITGALFKHCEKRSGASGDLIPQEKIVNLVNDIFGAGFDTITTAISWSLMYLVTKPEIQRKIQKELDTVIGRGRRPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTTLKGFYIPKECCVFINQWQVNHDPQLWGDP 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_MESAU (Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.311e-19
Identity = 62/233 (26.61%), Postives = 111/233 (47.64%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYG-DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAS--TKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F +R++  D  L + +  L+ E  ++  S    Y  DFIPILR      L   K++ ++     +    E  +       + +++  ++   D  LD     ++++D V+ I+ ++  A  +T   +I W +  LV +P +Q+K++ ELDTV+G   +    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  200 NVICAMCFGQRYDHDDQELLSIVN-LSNEFGKVTGS---GYPPDFIPILRYLPNSSLDAFKDLNKKFYSFMQKSVKEHYRTFEKGHIRDITDSLIEHCQDKSLDENANVQLSDDRVINIIVDLFGAGFDTVTTAISWSLMYLVTNPGVQRKIQEELDTVIGRSRRPRLCDRSQLPYLEAFILETFRHSSFLPFTIPHSTTRDTSLCGFYIPKGHCVFVNQWQINHNQELWGDP 428          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C79A2_ARATH (Phenylalanine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.311e-19
Identity = 59/227 (25.99%), Postives = 108/227 (47.58%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL---DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F +  E    P    ++ +    + L   + +   D++P LR   L G+ K+      R +  + D FV+ER  L   ++   +  +  +D  +   D   K  ++++ +   V  + +A ++    + EWG+AE++N P I +K   E+D V+G    + E D   L Y++A +KE  RL    P  +PHM+  D  + GY +P  S +L++   +   P+ W KP
Sbjct:  210 FGKGSEDGSGPGLEEIEHVESLFTVLTHLYAFALSDYVPWLRFLDLEGHEKVVSNAM-RNVSKYNDPFVDER--LMQWRNGKMKEPQDFLDMFIIAKDTDGKPTLSDEEIKAQVTELMLATVDNPSNAAEWGMAEMINEPSIMQKAVEEIDRVVGKDRLVIESDLPNLNYVKACVKEAFRLHPVAPFNLPHMSTTDTVVDGYFIPKGSHVLISRMGIGRNPSVWDKP 433          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_PONAB (Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 1.712e-19
Identity = 58/194 (29.90%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            DF PILR      L+  K   +R L+  +    E  +           S++  +  +     KG       I ++ ++ +V +I  A  +T   +I W +  LV  PEIQ+K++ ELDT++G G +    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P E  + VN W + + P  W+ P
Sbjct:  237 DFFPILRYLPNPALQRFKAFNQRFLRFLRKTVQEHYQ------DFDKNSVQDIMGALFKYSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTMIGRGRRPRLSDRPQLPYLKAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKECCVFVNQWQVNHDPELWEDP 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_STECH (Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.712e-19
Identity = 65/227 (28.63%), Postives = 106/227 (46.70%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHI----LDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++     L N L  L+ E  ++  S   N  DFIPIL+      +K    + +R    F    V E       K    +     IDH     LD  +  +++++ ++ IV ++  A  +T   ++ W +  LV +PEIQ++L  E++  +GP       D  KLP+L+A I ET R    +P  +PH    D  L GY +P ++ + +N W + +    WK P
Sbjct:  208 FGRRYDHNHQELLN-LVNLSDEFGQVVASG--NPADFIPILQYLPSTTMKKFLNINDR-FNTFVQKIVSEHYTTFD-KDNIRDITDSLIDHCEDRKLDENSNVQMSDEKIVGIVNDLFGAGFDTISTALSWSVMYLVAYPEIQERLYQEMNETVGPDRTPCLSDKPKLPFLEAFILETFRHSSFLPFTIPHCTSKDTSLNGYFIPKDTCVFINQWQINHDAELWKDP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.712e-19
Identity = 50/193 (25.91%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  128 YNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +N GDFIP +    L+G  +  K + +++  +  +  ++E  + A  +  + + L   +    +     ++N  NV  ++ ++  A  +T+   IEW +AE++NH +I  +   E+D V+G   ++ + D   LPY QA+ KET R   + PL +P ++    ++ G+ +P  ++++VN W +   P  W+ P
Sbjct:  234 FNIGDFIPYIAWMDLQGIQRDMKVI-QKKFDVLLNKMIKEHTESAHDRKDNPDFLDILMAATQENTEGIQLNLVNVKALLLDLFTAGTDTSSSVIEWALAEMLNHRQILNRAHEEMDQVIGRNRRLEQSDIPNLPYFQAICKETFRKHPSTPLNLPRISTEACEVDGFHIPKNTRLIVNIWAIGRDPKVWENP 425          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BN_ARATH (Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.712e-19
Identity = 46/125 (36.80%), Postives = 79/125 (63.20%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGH-QITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++  D++  I+ +I +A + T+  +I W + EL+ +P + KK+++E+ TVLG    +ITE D ++L Y + VIKET RL  A PLL+P   +   K+ GYD+P +++I+VN + +   P  W+ P
Sbjct:  287 KLTTDHIKGIISDIFLAGVNTSATTILWAMTELIRNPRVMKKVQDEVRTVLGEKRDRITEQDLNQLNYFKLVIKETFRLHPAAPLLLPREAMAKIKIQGYDIPEKTQIMVNVYAIGRDPDLWENP 411          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.236e-19
Identity = 72/239 (30.13%), Postives = 118/239 (49.37%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFES---QDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLY-IVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            L+++N + R++  +R+ S    DD   NR      E  RLA +F    GD IP LR F   GY    +E  +   ++  ++  E R+K    +++  + L   +  +L+ +T   +N D V+   V  +  A  E ++ ++ W  + ++N+P + +KL+ ELD  +G    I E D  KL YLQAV+KETLRL    PL  P     D  +GGY V   ++++ N   +      W  P
Sbjct:  191 LLVFNMILRMVCGKRYFSASTSDDEKANRCVKAVDEFVRLAATF--TVGDAIPYLRWFDFGGYENDMRETGKELDEIIGEWLDEHRQKRKMGENV--QDLMSVLLSLLEGKTIEGMNVDIVIKSFVLTVIQAGTEASITTLIWATSLILNNPSVLEKLKAELDIQVGKERYICESDLSKLTYLQAVVKETLRLYPPAPLSRPREFEEDCTIGGYTVKKGTRLITNLSKIHTDHNVWSNP 425          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_MACMU (Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.920e-19
Identity = 59/233 (25.32%), Postives = 107/233 (45.92%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKL---ASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F +R++     L + +   N     +      N  DFIPILR      L   K++ E+    F    ++E  K       + +++  ++   +  LD     +++++ ++ +V ++  A  +T   +I W +  LV +P +Q+K++ ELDTV+G   +    D   LPY++A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  196 NVICAICFGQRYDHNHQELLSLVNLSNNFGEVVGSG---NPADFIPILRYLPNRSLNGFKDLNEK-FHSFMQKMIKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANIQLSDEKIVNVVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNP 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_MACFA (Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.920e-19
Identity = 62/234 (26.50%), Postives = 105/234 (44.87%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHI----LDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I F +R++     L + +   N     +      N  DFIPILR      L   K++ E+    F    ++E  K    K    +     I+H     LD     +++++ ++ +V ++  A  +T   +I W +  LV +P +Q+K++ ELDTV+G   +    D   LPY++A I ET R    +P  +PH    D  L G+ +P    + VN W + +    W  P
Sbjct:  196 NVICAICFGQRYDHNHQELLSLVNLSNNFGEVVGSG---NPADFIPILRYLPNRSLNGFKDLNEK-FHSFMQKMIKEHYKTFE-KGYIRDITDSLIEHCQEKQLDENANIQLSDEKIVNVVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNP 424          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP1A2_CALJA1.311e-1928.44Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A... [more]
CP1A1_MESAU1.311e-1926.61Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP... [more]
C79A2_ARATH1.311e-1925.99Phenylalanine N-hydroxylase OS=Arabidopsis thalian... [more]
CP1A2_PONAB1.712e-1929.90Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2... [more]
CP1A1_STECH1.712e-1928.63Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1... [more]
C75A6_CAMME1.712e-1925.91Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C71BN_ARATH1.712e-1936.80Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=C... [more]
C82A2_SOYBN2.236e-1930.13Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=... [more]
CP1A1_MACMU2.920e-1925.32Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE... [more]
CP1A1_MACFA2.920e-1926.50Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top