FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_FELCA (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.920e-19
Identity = 56/203 (27.59%), Postives = 105/203 (51.72%), Query Frame = 2
Query:  131 NYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEIN------------EDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  D  P+L+ F    L+  K   + R +L ++  +E+ K+     + SN+S+   +D ++ A+   + N            + ++L  + +I  A +ETT   + W +A L++HP++ KKL+ E+D  +G     T  D ++L  L+A I+E LR+R   P L+PH  + D+ +G + V   + +++N W L +    W +P
Sbjct:  213 NLVDIFPVLKIFPNKTLEKMKNYVKNRDELLRE-ILEKHKE-----NFSNDSITNMLDVLIQARMNSDNNGAASDQDSKLLSDKHILTTIGDIFGAGVETTTSVVRWTVAFLLHHPQLYKKLQEEIDQNIGFSRTPTMSDRNQLILLEATIREVLRIRPVAPTLIPHKAIMDSSIGEFAVDKGTNVIINLWALHHNEKEWYRP 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C80B2_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.920e-19
Identity = 63/192 (32.81%), Postives = 98/192 (51.04%), Query Frame = 2
Query:  131 NYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  D+ P+L  F L G  K   EV E    ++  +    +++  + K    +S    +D  LD+     +N+  +  ++  +  A  ET+  +IEW + EL  +P+I  KLR+EL TV+G    + E D   LPYL+A +KETLRL    PLL+P   L    +  Y +P + +I+VNAW +   P  W  P
Sbjct:  215 NPADYFPMLGKFDLFGQRK---EVAECLKGIYAIWGAMLQERKLAKKVDGYQSKNDFVDVCLDSG----LNDYQINALLMELFGAGTETSASTIEWAMTELTKNPKITAKLRSELQTVVGE-RSVKESDFPNLPYLEATVKETLRLHPPTPLLLPRRALETCTILNYTIPKDCQIMVNAWGIGRDPKTWIDP 398          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AD_ARATH (Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=CYP71A13 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.920e-19
Identity = 53/193 (27.46%), Postives = 106/193 (54.92%), Query Frame = 2
Query:  125 EYNYGDFIPILRPF--LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP-GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            E+  G+++PIL     +RG+    KEV  R      D  V+E  + ++ K+   + +   +    D  +  ++  +++ +++ ++ +    TT   +EW + EL+  P+  KKL++E+ + + P G  I E +   + YL+AVIKE LRL  ++P+++P +   D K+ GY++ A +++++NAW +    A W
Sbjct:  215 EFPIGEYVPILAWIDGIRGFNNKIKEVS-RGFSDLMDKVVQEHLEASNDKA---DFVDILLSIEKDKNSGFQVQRNDIKFMILDMFIGGTSTTSTLLEWTMTELIRSPKSMKKLQDEIRSTIRPHGSYIKEKEVENMKYLKAVIKEVLRLHPSLPMILPRLLSEDVKVKGYNIAAGTEVIINAWAIQRDTAIW 403          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 3.814e-19
Identity = 59/190 (31.05%), Postives = 101/190 (53.16%), Query Frame = 2
Query:  152 ILRPFLRGYLKICKEVKERRLQLFKDY--FVEERKKLASTKSMSNESLKCAIDHILDAQTKGE---INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP-GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ILR   + +L+I ++ ++  L L +     VEERK+  S +    + ++  +D +LD +   E   +NE++++ +      A  +TT  +++W +A LV +PEIQ++L  E+ +V+G    ++ E D  K+PYL+AV+ E LR       L+PH    D  LGGY VP    I      +   P  W++P
Sbjct:  227 ILRKRWQEFLQIRRQQRDVLLPLIRARRKIVEERKR--SEQEDKKDYVQSYVDTLLDLELPEENRKLNEEDIMNLCSEFLTAGTDTTATALQWIMANLVKYPEIQERLHEEIKSVVGEEAKEVEEEDVEKMPYLKAVVLEGLRRHPPGHFLLPHSVTEDTVLGGYKVPKNGTINFMVAEIGRDPVEWEEP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71B7_ARATH (Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.814e-19
Identity = 47/143 (32.87%), Postives = 83/143 (58.04%), Query Frame = 2
Query:  299 IDHILDAQTKGE-------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +D +LD   K E       +  D++  I+ +I +A + T+  ++ W +AEL+ +P + KK+++E+ T LG   Q ITE D  ++ Y + V+KE  RL  A PLL+P   +   K+ GYD+P ++++++N + +A  P  W  P
Sbjct:  272 VDVMLDLMKKQEKDGESFKLTTDHLKGIISDIFLAGVNTSAVTLNWAMAELIRNPRVMKKVQDEIRTTLGDKKQRITEQDLSQVHYFKLVVKEIFRLHPAAPLLLPRETMSHVKIQGYDIPVKTQMMINIYSIARDPKLWTNP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.981e-19
Identity = 55/192 (28.65%), Postives = 95/192 (49.48%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIV----ENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D++PIL PF     K   EV+  +++       + R+ + +  S    +    +D + D + +G+ +  +   +V    E +N    +TT  ++EWGIA+L+ +P +Q KL  E+   +G   ++ E D  K+PYL AV+KE LR       ++ H       LGGYD+P ++ + V    +A  P  W  P
Sbjct:  227 DYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAIQNPGSDHTATTFSYLDTLFDLKVEGKKSAPSDAELVSLCSEFLN-GGTDTTATAVEWGIAQLIANPNVQTKLYEEIKRTVGE-KKVDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYTPAIAEDPKNWLNP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BS_ARATH (Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.981e-19
Identity = 47/147 (31.97%), Postives = 88/147 (59.86%), Query Frame = 2
Query:  275 SNESLKCAIDHILDAQTKGE---INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            S++ +   ID +   + +G+      D++  ++ +I +A + T+  ++ W + EL+ +P + KK+++E+ T LG   + ITE D ++L Y + ++KE  RL  A PLL+P   L   K+ GYD+PA+++I++NA+ +A  P  W  P
Sbjct:  262 SSDIIDVMIDMMKKQEKEGDSFKFTTDHLKGMISDIFLAGVGTSSTTLIWAMTELIRNPRVMKKVQDEIRTTLGDKKERITEEDLNQLHYFKLMVKEIFRLHPAAPLLLPRETLSHVKIQGYDIPAKTQIMINAYAIARDPKLWTNP 408          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BJ_ARATH (Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.981e-19
Identity = 71/240 (29.58%), Postives = 116/240 (48.33%), Query Frame = 2
Query:   20 MYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPI-----LRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG------EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++R+   + F   D     +++ L  E      SF  +  DF P+     L  +  G  K   +V  +   LF+    +    L   +S  +E +   ID +LD   K       E+  D++   + NI +A I+T   ++ W + ELV +P++ KK++ ++   LG   + ITE D  K+PYL+ VIKET RL  A PL++P   +   K+ GYD+P + +ILVN   +   P  W  P
Sbjct:  181 LFRVALGQNFHESDFIDKEKIEELVFEAETALASFTCS--DFFPVAGLGWLVDWFSGQHKRLNDVFYKLDALFQHVIDDH---LNPGRSKEHEDI---IDSMLDVIHKQGEDSSLELTIDHIKGFLANIFLAGIDTGAITMIWAVTELVKNPKLIKKVQGDIREQLGSNKERITEEDIEKVPYLKMVIKETFRLHPAAPLILPRETMAHIKVQGYDIPPKRRILVNVSAIGRDPKLWTNP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AM_ARATH (Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.981e-19
Identity = 42/121 (34.71%), Postives = 74/121 (61.16%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            EI+  ++  I+ ++ V   +T+   +EW + EL++ PE   +L+ E+ T+      ++E D   + YL+AVIKET+RL   +PL+VPH +  D +LG Y +PA +++++NAW +    A W
Sbjct:  276 EIDRLSIKAIILDVVVGGTDTSYALMEWAMTELLHRPECLNRLQEEVRTICKGNSSVSEDDIKDMNYLKAVIKETMRLHPPLPLMVPHESTQDVRLGDYHIPAGTQVMINAWAIGREAATW 396          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP21A_BOVIN (Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 6.506e-19
Identity = 65/199 (32.66%), Postives = 99/199 (49.75%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTK-SMSNESLKCAIDHILDA-------QTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPG---HQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D +P LR F    L   K+  E R     D+ VE  K+L   K SM     +   D++L         +  G++ E +V   V ++ +   ETT  ++ W +A L++HPEIQ++L+ ELD  LGPG    ++T  D  +LP L A I E LRLR  +PL +PH     + + GYD+P    ++ N          W++P
Sbjct:  209 DMVPFLRFFPNPGLWRLKQAIENR-----DHMVE--KQLTRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLSWAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPLALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQP 400          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP17A_FELCA2.920e-1927.59Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis ... [more]
C80B2_ESCCA2.920e-1932.81(S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS... [more]
C71AD_ARATH2.920e-1927.46Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=C... [more]
C89A2_ARATH3.814e-1931.05Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CY... [more]
C71B7_ARATH3.814e-1932.87Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CY... [more]
C77A3_SOYBN4.981e-1928.65Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=... [more]
C71BS_ARATH4.981e-1931.97Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=C... [more]
C71BJ_ARATH4.981e-1929.58Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=C... [more]
C71AM_ARATH4.981e-1934.71Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=C... [more]
CP21A_BOVIN6.506e-1932.66Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top