FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEAE (Chaperone protein htpG OS=Pseudomonas aeruginosa GN=htpG PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.821e-33
Identity = 86/219 (39.27%), Postives = 122/219 (55.71%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  NK K+A LLR+ ST   SG++  +L DY+ RMKEGQ+ IYY+TGES   V+NSP LE  +KKG EVL + D IDE+ +  L EF+GK+ V   +  L L   +SE++KK +E + +  EGL + +K VL                P  L  GE      M +I++A   +         SK   EINP++P++E+L    D D+
Sbjct:  383 NFGQVLKEGPAEDFGNKEKIAGLLRFASTGDDSGEQSVALADYIGRMKEGQDKIYYLTGESYSQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLPEFDGKQFVDVARGDLDLGSLDSEEDKKAQEEVAKSKEGLIERLKKVLDEQVSEVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQK------VPDSKPIFEINPQHPLIEKLDAEPDEDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NITMU (Chaperone protein htpG OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=htpG PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.685e-33
Identity = 83/211 (39.34%), Postives = 121/211 (57.35%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE--KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            F + +K G+ ED  N+ ++A+LLR+ ST S  E    SL DYV RMK+GQ  IYY+T +S  A ++SP LE  +KK  EV+ + D +DE+ V  L EFEGK L S  K  L L + EDE + KE  KE  +++ L + IK+VLG               P CLVT  +  + N+ER++K+   +         +K  +EINP +P++E L+
Sbjct:  389 FGQVMKEGVAEDYANRERIAKLLRFVSTHSDSEEQDVSLSDYVGRMKDGQEKIYYVTADSLTAAKSSPHLEIFRKKDIEVILLFDRVDEWLVANLPEFEGKHLQSVAKGSLDLGKLEDEAEKKEQEKEAGEYKELTEKIKEVLGEQVKDVRITLRLTESPACLVTETHDMSGNLERLLKSAGQK------VTHTKPILEINPYHPMVERLK 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: H90B2_HUMAN (Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 4.812e-33
Identity = 74/141 (52.48%), Postives = 92/141 (65.25%), Query Frame = 2
Query:  110 SLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKA 532
            S+++YV+RMKE Q  IYYITGESK+ V NS F+E++ K+   V+YM + ID Y   QLKEF+GK LVS TKEGL+L E  +EKK  E  K KFE LCK +K+ L                 CC+VT  Y WTANME+IMKA
Sbjct:  244 SVEEYVSRMKEIQKSIYYITGESKEQVANSAFVEQVWKRDSRVVYMTEPIDGY---QLKEFDGKSLVSVTKEGLELPEDGEEKKRMEERKAKFENLCKFMKETLDKKVEMVTVSNRLVSSSCCIVTSTYSWTANMEQIMKA 381          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEA7 (Chaperone protein htpG OS=Pseudomonas aeruginosa (strain PA7) GN=htpG PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.209e-33
Identity = 85/219 (38.81%), Postives = 121/219 (55.25%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  NK K+A LLR+ ST   SG++  +L DY+ RMKEGQ+ IYY+TGES   V+NSP LE  +KKG EVL + D IDE+ +  L +F+GK  V   +  L L   +SE++KK +E + +  EGL + +K VL                P  L  GE      M +I++A   +         SK   EINP++P++E+L    D D+
Sbjct:  383 NFGQVLKEGPAEDFGNKEKIAGLLRFASTGGDSGEQSVALADYIGRMKEGQDKIYYLTGESYSQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLPDFDGKSFVDVARGDLDLGSLDSEEDKKAQEEVAKSKEGLIERLKKVLDEQASEVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQK------VPESKPIFEINPQHPLIEKLDAEPDEDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HAHCH (Chaperone protein htpG OS=Hahella chejuensis (strain KCTC 2396) GN=htpG PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.209e-33
Identity = 91/222 (40.99%), Postives = 122/222 (54.95%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDE--LTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKA--QALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            F + LK G  ED  N+ K+A+L+R+ ST   D+    SL+DYV+RMK+GQ+ IYYIT ES  A   SP LE  +KKG EVL M D IDE+ +  L EF+GK      K  L L E ED  EK+ +E + ++ E L   +K+VL                P CLV G Y     M RIM+A  QAL +        SK T EINP++P++++L +   A   D
Sbjct:  390 FGRVLKEGPAEDFINREKIAKLMRFSSTHQDDDKQTQSLEDYVSRMKQGQDKIYYITAESYSAGVKSPHLEIFRKKGIEVLVMHDRIDEWLMSHLNEFDGKHFQDIAKGELDLGEVEDKEEKEKQEEVSKEAEPLLNRLKEVLKDHVEEVRVTHRLTDSPACLVVGAYDMGVQMRRIMEAAGQALPE--------SKPTFEINPDHPLVKKLGEEQGARFED 603          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_DECAR (Chaperone protein htpG OS=Dechloromonas aromatica (strain RCB) GN=htpG PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.209e-33
Identity = 82/212 (38.68%), Postives = 120/212 (56.60%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLK--EKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F   LK G+ ED  NK K+A L+R+ ST +   ++  SL DY+ RMKEGQ  IY++T ++  A +NSP LE  +KKG EVL + D +DE+ VG L EF+GK L S  K GL L + EDE + +E  K  + ++ L + +K  LG               P CLV+ E+  + N+ R+MKA            +SK  +EINP++P +  L+
Sbjct:  386 AFGSVLKEGVGEDHANKEKIAGLIRFSSTHNDTAEQNVSLADYIGRMKEGQEKIYFVTADTFNAAKNSPHLEIFRKKGIEVLLLSDRVDEWVVGHLTEFDGKHLQSVAKGGLDLGKLEDEAEKQEAEKAADDYKELLEKVKTSLGDKVKDVRVTYRLTDSPSCLVSDEHDPSGNLARLMKAAG------QPMPNSKPILEINPQHPAVMRLK 591          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HALHL (Chaperone protein htpG OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=htpG PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.400e-32
Identity = 79/213 (37.09%), Postives = 119/213 (55.87%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYM--SSKKTMEINPENPIMEEL 622
            +F +  K GI ED  N+ ++A LLR+ ST    E    SL DYV RMK+GQ  IYY+T ES  A  NSP LE  ++ G EVL + D +DE+ V  L E++GK+L S  K  L L+    ED+K+ ++  ++ +E LCK + + LG               P CLV GEY +   M+R+++A        AG+   + +  +E+NP++ ++E L
Sbjct:  386 AFGRVFKEGIAEDPGNRERIARLLRFSSTHEEKETPDVSLDDYVARMKDGQEKIYYVTAESFNAARNSPHLEIFRRHGIEVLLLPDPVDEWLVAHLHEYDGKQLASVAKGELDLEALGEEDDKQARQEKEQAYEDLCKRLGETLGERVSEVRVSHRLTDSPACLVVGEYDFGMGMQRLLQA--------AGHQLPAGQPALEVNPDHSVIERL 590          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEPK (Chaperone protein htpG OS=Pseudomonas putida (strain KT2440) GN=htpG PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.388e-32
Identity = 86/220 (39.09%), Postives = 118/220 (53.64%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGL---KLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  NK K+A LLR+ ST+  SG++  +L DY+ R KEGQ+ IYY+TGES   V+NSP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L   KLD  ED+K  +E  K+K EGL + +K  LG               P  L  GE      M +I++A   +         SK   E NP +P++E+L      D+
Sbjct:  383 NFGQVLKEGPAEDFANKEKIAGLLRFASTQDDSGEQSVALADYLARAKEGQDKIYYLTGESYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLNEFDGKAFVDIARGDLDLGKLDSEEDKKAQEEVAKDK-EGLVERLKGALGDSVAEVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQK------VPESKPIFEFNPSHPLIEKLDHEQSEDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEMY (Chaperone protein htpG OS=Pseudomonas mendocina (strain ymp) GN=htpG PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.119e-32
Identity = 88/220 (40.00%), Postives = 119/220 (54.09%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKS-GDELT-SLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGL---KLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  NK K+A LLR+ ST   GDE + SL DY+ R+K+GQ+ IYY+TGES   ++NSP LE  +KKG EVL + D IDE+ +  L EF+GK+ V   +  L   KLD  ED+K  +E  K K EGL + +K  LG               P  L  GE      M +I++A   +         SK   E NP +P++E L   AD D+
Sbjct:  383 AFGQVLKEGPAEDFANKEKIAGLLRFASTAGEGDEQSVSLADYLGRVKDGQDKIYYLTGESYAQIKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLTEFDGKQFVDVARGDLDLGKLDSEEDKKAQEEVAKAK-EGLIERLKGALGEQVKEVRVSHRLTDSPAILAIGEQDLGLQMRQILEASGQK------VPESKPIFEFNPSHPLIERLDAEADEDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BORPE (Chaperone protein htpG OS=Bordetella pertussis GN=htpG PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.076e-32
Identity = 79/220 (35.91%), Postives = 122/220 (55.45%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            F + LK G  ED+ N+ ++A LLR+ ST  G++    S  DYV RMK+GQ+ IYY+T ++  A  NSP LE  +KKG EVL + D +DE+ +  L+EF+GK LVS  K GL L E   E+EKK +  + E F+ L + ++  L                P C+V G+   + ++ R++KA       +      K  +EINP++ ++  +R  +DA+  D
Sbjct:  388 FGQVLKEGTGEDAANRERIARLLRFASTHDGEQAQTVSFADYVGRMKDGQDKIYYVTADTFTAAANSPHLEIFRKKGIEVLLLSDRVDEWMLSYLREFDGKSLVSVAKGGLDLAELADEEEKKRQSEVAETFKPLVERLQQALAEQVKEVRVTQRLVDSPACVVVGQNELSPHLLRMLKAAGQEAPEV------KPVLEINPDHALVARIRDASDAEFGD 601          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_PSEAE2.821e-3339.27Chaperone protein htpG OS=Pseudomonas aeruginosa G... [more]
HTPG_NITMU3.685e-3339.34Chaperone protein htpG OS=Nitrosospira multiformis... [more]
H90B2_HUMAN4.812e-3352.48Putative heat shock protein HSP 90-beta 2 OS=Homo ... [more]
HTPG_PSEA78.209e-3338.81Chaperone protein htpG OS=Pseudomonas aeruginosa (... [more]
HTPG_HAHCH8.209e-3340.99Chaperone protein htpG OS=Hahella chejuensis (stra... [more]
HTPG_DECAR8.209e-3338.68Chaperone protein htpG OS=Dechloromonas aromatica ... [more]
HTPG_HALHL1.400e-3237.09Chaperone protein htpG OS=Halorhodospira halophila... [more]
HTPG_PSEPK2.388e-3239.09Chaperone protein htpG OS=Pseudomonas putida (stra... [more]
HTPG_PSEMY3.119e-3240.00Chaperone protein htpG OS=Pseudomonas mendocina (s... [more]
HTPG_BORPE9.076e-3235.91Chaperone protein htpG OS=Bordetella pertussis GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top