FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_LEGPC (Chaperone protein htpG OS=Legionella pneumophila (strain Corby) GN=htpG PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.003e-30
Identity = 83/213 (38.97%), Postives = 117/213 (54.93%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ +T SG E    SL++Y++RMKEGQ+ IYYIT  S  A +NSP LE  +KKG EVL + D +DE+ VG + EF GKKL S +K  ++L + E  +++KE  ++  E L K IK VL                P C+V  E      M+RI++A   +         SK   EINP++ +++ L    D
Sbjct:  378 FGLVLKEGPIEDFANKEAIAKLLRFSTTASGSEKQEVSLEEYISRMKEGQDKIYYITASSYNAAKNSPHLEIFRKKGIEVLLLSDKVDEWLVGYMNEFAGKKLQSISKGKIELGDDETSEQIKEQ-EKTLEPLIKHIKSVLNERVKDVLLTNRLTDSPACVVADEQDMGLEMQRILQAAGQQ------VPVSKPIFEINPDHALIKRLHDIQD 583          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHESM (Chaperone protein htpG OS=Shewanella sp. (strain MR-4) GN=htpG PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.311e-30
Identity = 85/215 (39.53%), Postives = 117/215 (54.42%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQ  IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L E+   L + IK  LG               P C+VTGE   ++ M ++M+A              K T EINP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYLSRMKEGQTKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGELELGELEDAAEKEAQEKLAEESAPLVERIKAALGASVADVKVTSRLTDTPACVVTGEGEMSSQMIKLMQAAG------QPVPEVKPTFEINPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEON (Chaperone protein htpG OS=Shewanella oneidensis GN=htpG PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.311e-30
Identity = 84/215 (39.07%), Postives = 116/215 (53.95%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQ  IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L E+   L + IK  LG               P C+VTGE   +  M ++M+A              K T E+NP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYISRMKEGQTKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGELELGELEDAAEKEAQEKLAEESAPLIERIKAALGASVADVKVTSRLTDTPACVVTGEGEMSTQMIKLMQAAG------QPVPEVKPTFEVNPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_METCA (Chaperone protein htpG OS=Methylococcus capsulatus GN=htpG PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.311e-30
Identity = 84/215 (39.07%), Postives = 114/215 (53.02%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G+ ED  NK +LA+LLR+ ST   S ++  +L +YV+RMKEGQ+ IY+++ ES  A  NSP LE  +KK  EVL + D IDE+ V  L E+EGK L S  +  L L   E E+EK      KE F  L + +K  L                P CL++  YG +  MERIMK+             SK  +EINP + ++  L   AD
Sbjct:  385 FGQVLKEGLIEDFANKDRLAKLLRFSSTHTDSEEQTVTLDEYVSRMKEGQDKIYFVSAESFGAARNSPHLEIFRKKDIEVLLLSDRIDEWLVSYLTEYEGKPLQSVARGDLDLGKLEGEEEKAEAAAEKEAFAPLTERLKKALEAKVNDVRLSHRLTDSPACLISESYGMSRTMERIMKSAG------QNIPGSKPILEINPHHGLIARLNTEAD 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MYCLE (Chaperone protein htpG OS=Mycobacterium leprae GN=htpG PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.712e-30
Identity = 81/224 (36.16%), Postives = 118/224 (52.68%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKET----LKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVK 664
            F K LK G+  DS N+  L  +  + ST S +E T+L  YV RMK+GQ+ I+Y TGES++ V NSP LE  K KGYEVL + D +DE  VG   EF+GK L S  +  + L ESE+EK   E      ++ F GL   +K+ L                P CL+T  +G T  + RI +A      S       K+ +E+NP +P++  L++  +   +D  ++
Sbjct:  401 FGKVLKEGLMSDSDNRDTLLHISSFASTHSDEEPTTLAQYVERMKDGQDQIFYATGESRQQVMNSPHLEAFKAKGYEVLLLTDPVDEVWVGMAPEFDGKPLKSVARGEVDL-ESEEEKTAHEAERKEQEQNFAGLVNWLKETLSDHVKEVRLSTRLTESPACLITDAFGITPALARIYRA------SGQDVPFGKRILELNPNHPLITGLQQAHENGGDDTHLR 617          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEFN (Chaperone protein htpG OS=Shewanella frigidimarina (strain NCIMB 400) GN=htpG PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.235e-30
Identity = 83/215 (38.60%), Postives = 115/215 (53.49%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELT--SLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  NK ++A LLR+ ST      T  SL+ Y+ RMK GQ+ IYYI  +S +A  NSP LE L+KKG EVL + + IDE+ V  L EF+ KKL S T+  L+L E ED  +K+  + + E+ +GL + +K  L                P C+V GE   +  M ++M+A             SK T EINP +P++E L    D
Sbjct:  387 FGQVLKEGPAEDFANKERIAGLLRFASTHDNSAATTVSLEAYIERMKAGQDKIYYIVADSHEAAANSPHLELLRKKGIEVLLLSERIDEWLVNHLTEFKDKKLHSVTRGDLELGELEDAADKEAHDKVAEESKGLIERVKAALADSVSEVRVTSRLTDTPACVVAGEGEMSTQMIKLMQAAG------QPVPESKPTFEINPTHPLVEHLNNETD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_PSEU2 (Chaperone protein htpG OS=Pseudomonas syringae pv. syringae (strain B728a) GN=htpG PE=3 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 2.235e-30
Identity = 86/243 (35.39%), Postives = 125/243 (51.44%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSL 718
            +F + LK G  ED  NK K+A LLR+ ST   SG++  SL +Y+ R KEGQ+ IYY+TGES   V+NSP LE  +KKG EVL + D IDE+ +  L +F+GK  V   +  L L   +SE++KK +E + +  EGL + +K  LG               P  L  GE      M +I++A   +         SK   E NP +P++ +L    DA++++    D            +G SL
Sbjct:  384 NFGQVLKEGPAEDFANKEKIAGLLRFASTSDDSGEQSVSLAEYLARAKEGQDKIYYLTGESYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLSDFDGKGFVDVARGDLDLGNLDSEEDKKAQEEIAKDKEGLIERLKAALGESVSEVRVSHRLTDSPAILAIGEQDMGLQMRQILEASGQK------VPDSKPIFEFNPAHPLIGKL----DAEQSEDRFGDLSHILFDQAALAAGDSL 616          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEPC (Chaperone protein htpG OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=htpG PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.920e-30
Identity = 84/215 (39.07%), Postives = 115/215 (53.49%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQ  IYYI  +S  A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L E+   L + IK  LG               P C+VTGE   +  M ++M+A              K T E+NP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYISRMKEGQTKIYYIVADSYDAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGELELGELEDAAEKEAQEKLAEESAPLIERIKAALGTKVADVKVTSRLTDTPACVVTGEGEMSTQMIKLMQAAG------QPVPEVKPTFEVNPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEB9 (Chaperone protein htpG OS=Shewanella baltica (strain OS195) GN=htpG PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.920e-30
Identity = 83/215 (38.60%), Postives = 116/215 (53.95%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQ  IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L+++   L + IK  LG               P C+V GE   +  M ++M+A              K T EINP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYISRMKEGQTKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGDLELGELEDASEKEAQEKLEQESVALVERIKAALGSTVADVKVTSRLTDTPACVVAGEGEMSTQMIKLMQAAG------QPVPEVKPTFEINPAHPLVSRLNDLQD 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHEB8 (Chaperone protein htpG OS=Shewanella baltica (strain OS185) GN=htpG PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.920e-30
Identity = 83/215 (38.60%), Postives = 116/215 (53.95%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F + LK G  ED  N+ ++A LLR+ ST +G      SL DY++RMKEGQ  IYYI  +S +A  NSP LE L+KKG EVL M + IDE+ +  L E++ K+L S T+  L+L E ED  EK+ +E L+++   L + IK  LG               P C+V GE   +  M ++M+A              K T EINP +P++  L    D
Sbjct:  387 FGQVLKEGPAEDFANRERIAGLLRFASTHTGSAAPTVSLDDYISRMKEGQTKIYYIVADSHEAAANSPHLELLRKKGIEVLLMSERIDEWLINHLTEYKEKQLHSVTRGDLELGELEDASEKEAQEKLEQESVALVERIKAALGSTVADVKVTSRLTDTPACVVAGEGEMSTQMIKLMQAAG------QPVPEVKPTFEINPAHPLVSRLNDLQD 595          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_LEGPC1.003e-3038.97Chaperone protein htpG OS=Legionella pneumophila (... [more]
HTPG_SHESM1.311e-3039.53Chaperone protein htpG OS=Shewanella sp. (strain M... [more]
HTPG_SHEON1.311e-3039.07Chaperone protein htpG OS=Shewanella oneidensis GN... [more]
HTPG_METCA1.311e-3039.07Chaperone protein htpG OS=Methylococcus capsulatus... [more]
HTPG_MYCLE1.712e-3036.16Chaperone protein htpG OS=Mycobacterium leprae GN=... [more]
HTPG_SHEFN2.235e-3038.60Chaperone protein htpG OS=Shewanella frigidimarina... [more]
HTPG_PSEU22.235e-3035.39Chaperone protein htpG OS=Pseudomonas syringae pv.... [more]
HTPG_SHEPC2.920e-3039.07Chaperone protein htpG OS=Shewanella putrefaciens ... [more]
HTPG_SHEB92.920e-3038.60Chaperone protein htpG OS=Shewanella baltica (stra... [more]
HTPG_SHEB82.920e-3038.60Chaperone protein htpG OS=Shewanella baltica (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top