FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MYCA1 (Chaperone protein htpG OS=Mycobacterium avium (strain 104) GN=htpG PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.920e-30
Identity = 80/240 (33.33%), Postives = 121/240 (50.42%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD-ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F + +K G+  D  N+  L +L  + ST S +E T+L  YV RMKEGQ  I+Y TGE+++ +  SP LE  K KGYEVL + D +DE  VG + EF+GK L S  K  + L  E E+ +  +E  +++F  L   +KD L                P CL+T  +G T  + R+ +A      S       K+ +E+NP++P++  LR+      +D SV +             G +LD
Sbjct:  394 FGRVVKEGLLSDFDNQETLLQLCSFASTHSEEEATTLAQYVERMKEGQTQIFYATGETRQQILKSPHLEAFKAKGYEVLLLTDPVDEVWVGTVTEFDGKPLQSIAKGEVDLSAEGEESQAEREEQQKEFADLLAWLKDTLSDHVKEVRLSNRLTDSPACLITDAFGITPALARLYRA------SGQDIPVGKRILELNPKHPLVTGLRQAHQDRADDPSVAETAELLYGTALLAEGGALD 627          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RHOFD (Chaperone protein htpG OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=htpG PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.813e-30
Identity = 80/210 (38.10%), Postives = 113/210 (53.81%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMK--AQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            F   LK G+ ED  NK +LA+LLR+ S+ +     S  DY  RMKEGQ  IYYIT ++  A +NSP LE  KKKG EVL M D +DE+A+  L+EF+G  L S  K  + L + +D  EKK  E   E F+ L   +K+ L                P CLV  ++G +  + R++K   QA  D         K  +E+N E+P++++L
Sbjct:  422 FGAVLKEGLGEDYANKDRLAKLLRFASSSTDTVSVSFADYKARMKEGQEAIYYITADTPAAAKNSPQLEVFKKKGIEVLLMTDRVDEWALNYLQEFDGTPLQSVAKGAVDLGKLQDEAEKKAAEEAAETFKPLLAKLKEALKDKAEDVRVTTRLVDSPACLVVQDHGMSTQLARMLKQAGQAAPD--------VKPVLEVNAEHPLVKKL 623          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_XANC5 (Chaperone protein htpG OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=htpG PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.980e-30
Identity = 80/219 (36.53%), Postives = 116/219 (52.97%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  N+ K+A LLR+ ST   +G +   L DYV+R+ EGQ+ +YY+TGES   +++SP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L L   +SE++KK +E L +  EGL   IK  LG               P  L  G+      M ++++A      S      SK   E NP +P++E+L    D D+
Sbjct:  383 NFGQALKEGPAEDYANREKIAGLLRFSSTHDTTGAQSVGLADYVSRLAEGQDKLYYLTGESYAQIKDSPHLEVFRKKGIEVLLLTDRIDEWLMSYLTEFDGKSFVDVARGDLDLGKLDSEEDKKAQEDLAKSKEGLASRIKAALGDDVAEVRVSHRLTDSPAILAIGQGDLGLQMRQLLEA------SGQAVPESKPVFEFNPTHPLIEKLDAEQDMDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBPA (Chaperone protein htpG OS=Vibrio parahaemolyticus GN=htpG PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.980e-30
Identity = 83/218 (38.07%), Postives = 116/218 (53.21%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE---KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F   LK G  ED  NK K+A LLR+ ST+  S ++   L  YV RMKEGQ+ IYY+T +S  A +NSP LE+ K KG EV+ M D IDE+ +  L EF+GK+  S TK GL L + EDE   +K KET +E+F+ + +  K  LG               P  +VT +Y     M +++ A              K   EINPE+ +++ +   AD +
Sbjct:  386 FGLVLKEGPAEDFANKEKIAGLLRFASTEVDSAEQTVGLASYVERMKEGQDKIYYLTADSYAAAKNSPHLEQFKAKGIEVILMFDRIDEWLMNYLTEFDGKQFQSITKAGLDLSKFEDEADKEKQKET-EEEFKSVVERTKSYLGDRVKDVRTTFKLASTPAVVVTDDYEMGTQMAKLLAAAG------QAVPEVKYIFEINPEHELVKRMADEADEE 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MYCPA (Chaperone protein htpG OS=Mycobacterium paratuberculosis GN=htpG PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.980e-30
Identity = 79/240 (32.92%), Postives = 121/240 (50.42%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD-ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            F + +K G+  D  N+  L +L  + ST S +E T+L  YV RMKEGQ  I+Y TGE+++ +  SP LE  K KGYEVL + D +DE  VG + EF+GK L S  K  + L  E E+ +  ++  +++F  L   +KD L                P CL+T  +G T  + R+ +A      S       K+ +E+NP++P++  LR+      +D SV +             G +LD
Sbjct:  394 FGRVVKEGLLSDFDNQETLVQLCSFASTHSEEEATTLAQYVERMKEGQTQIFYATGETRQQILKSPHLEAFKAKGYEVLLLTDPVDEVWVGTVTEFDGKPLQSIAKGEVDLSAEGEESQAERDEQQKEFADLLAWLKDTLSDHVKEVRLSNRLTDSPACLITDAFGITPALARLYRA------SGQDIPVGKRILELNPKHPLVTGLRQAHQDRADDPSVAETAELLYGTALLAEGGALD 627          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_AERHH (Chaperone protein htpG OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=htpG PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.980e-30
Identity = 80/210 (38.10%), Postives = 117/210 (55.71%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE--KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            F   LK G  ED  N+ ++A+LLR+ ST    E    SL+DYV RMKEGQ  IYYIT +S  A +NSP LE  +KKG EVL M + +DE+ +  L EF+GK+LVS T+  L L + EDE  K+ +E  ++   GL + +K  LG               P C+VT  +G +  M ++M+A              K  +E+NP++ ++++L
Sbjct:  393 FGNVLKEGPAEDYANREEIAKLLRFASTAGEGEAQTVSLEDYVGRMKEGQQKIYYITADSYAAAKNSPHLEIFRKKGVEVLLMWERVDEWLMSHLTEFDGKQLVSVTRGELDLGDLEDEASKQAQEEAEKANAGLVERVKQSLGEAVKEVRVTHRLTDSPSCIVTDAHGMSTQMIKLMRAAG------QPVPEQKYILELNPDHALVKKL 596          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_XANOR (Chaperone protein htpG OS=Xanthomonas oryzae pv. oryzae GN=htpG PE=3 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 81/220 (36.82%), Postives = 115/220 (52.27%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGL---KLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  N+ K+A L+R+ ST   +G +   L DYV+R+ EGQ+ +YY+TGES   +++SP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L   KLD  ED+K  +E  K K EGL   IK  LG               P  L  G+      M ++++A      S      SK   E NP +P++E+L    D D+
Sbjct:  383 NFGQALKEGPAEDYANREKIAGLMRFSSTHDTTGAQSVGLADYVSRLAEGQDKLYYLTGESYAQIKDSPHLEVFRKKGIEVLLLTDRIDEWLMSYLTEFDGKSFVDVARGDLDLGKLDSEEDKKAQEEVAKSK-EGLASRIKAALGEDVAEVRVSHRLTDSPAILAIGQGDLGLQMRQLLEA------SGQAVPESKPVFEFNPTHPLIEKLDAEQDMDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_XANOM (Chaperone protein htpG OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 81/220 (36.82%), Postives = 115/220 (52.27%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGL---KLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK G  ED  N+ K+A L+R+ ST   +G +   L DYV+R+ EGQ+ +YY+TGES   +++SP LE  +KKG EVL + D IDE+ +  L EF+GK  V   +  L   KLD  ED+K  +E  K K EGL   IK  LG               P  L  G+      M ++++A      S      SK   E NP +P++E+L    D D+
Sbjct:  383 NFGQALKEGPAEDYANREKIAGLMRFSSTHDTTGAQSVGLADYVSRLAEGQDKLYYLTGESYAQIKDSPHLEVFRKKGIEVLLLTDRIDEWLMSYLTEFDGKSFVDVARGDLDLGKLDSEEDKKAQEEVAKSK-EGLASRIKAALGEDVAEVRVSHRLTDSPAILAIGQGDLGLQMRQLLEA------SGQAVPESKPVFEFNPTHPLIEKLDAEQDMDR 595          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBCM (Chaperone protein htpG OS=Vibrio cholerae serotype O1 (strain M66-2) GN=htpG PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 82/216 (37.96%), Postives = 116/216 (53.70%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE---KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   +K G  ED  N+ K+A LLR+ ST   S ++  SL  YV RMKEGQ+ IYY+T +S  A +NSP LE+ K KG EV+ M D IDE+ +  L EFEGK   S TK GL L + EDE   +K KET +E+F+ + + +K  LG               P  +VT +Y     M +++ A              K  +E+NPE+ +++ +   AD
Sbjct:  386 FGLVMKEGPAEDFANREKIASLLRFASTHIDSAEQTISLASYVERMKEGQDKIYYLTADSYTAAKNSPHLEQFKSKGIEVILMFDRIDEWLMNYLPEFEGKAFQSITKAGLDLSQFEDEAEKEKHKET-EEQFKSVVERLKGYLGSRVKEVRTTFKLANTPAVVVTDDYEMGTQMAKLLAAAG------QPVPEVKYILEVNPEHALVKRMADEAD 594          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_VIBCH (Chaperone protein htpG OS=Vibrio cholerae GN=htpG PE=2 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 6.504e-30
Identity = 82/216 (37.96%), Postives = 116/216 (53.70%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE---KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   +K G  ED  N+ K+A LLR+ ST   S ++  SL  YV RMKEGQ+ IYY+T +S  A +NSP LE+ K KG EV+ M D IDE+ +  L EFEGK   S TK GL L + EDE   +K KET +E+F+ + + +K  LG               P  +VT +Y     M +++ A              K  +E+NPE+ +++ +   AD
Sbjct:  386 FGLVMKEGPAEDFANREKIASLLRFASTHIDSAEQTISLASYVERMKEGQDKIYYLTADSYTAAKNSPHLEQFKSKGIEVILMFDRIDEWLMNYLPEFEGKAFQSITKAGLDLSQFEDEAEKEKHKET-EEQFKSVVERLKGYLGSRVKEVRTTFKLANTPAVVVTDDYEMGTQMAKLLAAAG------QPVPEVKYILEVNPEHALVKRMADEAD 594          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_MYCA12.920e-3033.33Chaperone protein htpG OS=Mycobacterium avium (str... [more]
HTPG_RHOFD3.813e-3038.10Chaperone protein htpG OS=Rhodoferax ferrireducens... [more]
HTPG_XANC54.980e-3036.53Chaperone protein htpG OS=Xanthomonas campestris p... [more]
HTPG_VIBPA4.980e-3038.07Chaperone protein htpG OS=Vibrio parahaemolyticus ... [more]
HTPG_MYCPA4.980e-3032.92Chaperone protein htpG OS=Mycobacterium paratuberc... [more]
HTPG_AERHH4.980e-3038.10Chaperone protein htpG OS=Aeromonas hydrophila sub... [more]
HTPG_XANOR6.504e-3036.82Chaperone protein htpG OS=Xanthomonas oryzae pv. o... [more]
HTPG_XANOM6.504e-3036.82Chaperone protein htpG OS=Xanthomonas oryzae pv. o... [more]
HTPG_VIBCM6.504e-3037.96Chaperone protein htpG OS=Vibrio cholerae serotype... [more]
HTPG_VIBCH6.504e-3037.96Chaperone protein htpG OS=Vibrio cholerae GN=htpG ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top