FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MYCBP (Chaperone protein htpG OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 76/221 (34.39%), Postives = 116/221 (52.49%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKM-KETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVK 664
            F + LK G+  D  N+  L  +  + ST S +E T+L +YV RMK+GQ  I+Y TGE+++ +  SP LE  K KGYEVL + D +DE  VG + EF+GK L S  K  + L   ED  +  +E  +++F  L   +++ L                P CL+T  +G T  + RI +A      S       K+ +E+NP +P++  LR +A  D+ D + K
Sbjct:  395 FGRVLKEGLLSDIDNRETLLGISSFVSTYSEEEPTTLAEYVERMKDGQQQIFYATGETRQQLLKSPHLEAFKAKGYEVLLLTDPVDEVWVGMVPEFDGKPLQSVAKGEVDLSSEEDTSEAEREERQKEFADLLTWLQETLSDHVKEVRLSTRLTESPACLITDAFGMTPALARIYRA------SGQEVPVGKRILELNPSHPLVTGLR-QAHQDRADDAEK 608          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_MYCBO (Chaperone protein htpG OS=Mycobacterium bovis GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 76/221 (34.39%), Postives = 116/221 (52.49%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKM-KETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVK 664
            F + LK G+  D  N+  L  +  + ST S +E T+L +YV RMK+GQ  I+Y TGE+++ +  SP LE  K KGYEVL + D +DE  VG + EF+GK L S  K  + L   ED  +  +E  +++F  L   +++ L                P CL+T  +G T  + RI +A      S       K+ +E+NP +P++  LR +A  D+ D + K
Sbjct:  395 FGRVLKEGLLSDIDNRETLLGISSFVSTYSEEEPTTLAEYVERMKDGQQQIFYATGETRQQLLKSPHLEAFKAKGYEVLLLTDPVDEVWVGMVPEFDGKPLQSVAKGEVDLSSEEDTSEAEREERQKEFADLLTWLQETLSDHVKEVRLSTRLTESPACLITDAFGMTPALARIYRA------SGQEVPVGKRILELNPSHPLVTGLR-QAHQDRADDAEK 608          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURPS (Chaperone protein htpG OS=Burkholderia pseudomallei GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURP1 (Chaperone protein htpG OS=Burkholderia pseudomallei (strain 1710b) GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURMS (Chaperone protein htpG OS=Burkholderia mallei (strain SAVP1) GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURMA (Chaperone protein htpG OS=Burkholderia mallei GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURM9 (Chaperone protein htpG OS=Burkholderia mallei (strain NCTC 10229) GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURM7 (Chaperone protein htpG OS=Burkholderia mallei (strain NCTC 10247) GN=htpG PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.951e-28
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  IYY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKIYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_IDILO (Chaperone protein htpG OS=Idiomarina loihiensis GN=htpG PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.356e-27
Identity = 74/216 (34.26%), Postives = 115/216 (53.24%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDE--KKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            +F   LK G  ED TN+ ++AELLR+ ST +   +   SL DY+ RMKEGQ+ I+YI  +S +A  N+P LE   KKG EVL + + IDE+ +  L EF+ K+L S T+  L L E +DE  K  +E  +E F+   +  +  LG               P C++T +   +  M ++M+A             +K   E+NPE+P+++ +  + D
Sbjct:  389 TFGNVLKEGPAEDHTNRERIAELLRFASTHNDGAVQSVSLDDYIERMKEGQDKIFYIVADSYEAARNNPALEIFNKKGIEVLLLSERIDEWLMSHLTEFKEKQLQSVTRGDLDLGELDDEEDKAEQEKAEEAFKENLERFEKALGDKVKKVRVTNRLTNSPACIITDDNDMSTQMAKLMEAAG------QAVPETKYIFEVNPEHPLVQRMLTKED 598          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BURP0 (Chaperone protein htpG OS=Burkholderia pseudomallei (strain 1106a) GN=htpG PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.356e-27
Identity = 72/211 (34.12%), Postives = 115/211 (54.50%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDEL--TSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE-SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELR 625
            +F + LK G+ ED  N+ ++A+LLR+ ST    +    +L DYV RMK  Q  +YY+T ++ +A +NSP LE  +KKG EVL + D +DE+ +  L EF+GK L S  +  L L   ++DEKK +E   E  + +   +K+ LG               P CLV  +   +  ++R++KA            S +  +EINPE+P+++ L+
Sbjct:  384 AFGQVLKEGVGEDHANRERVAKLLRFASTHGDTDAQDVALADYVARMKPEQTKLYYVTADTWQAAKNSPHLEVFRKKGVEVLLLTDRVDEWMLSFLHEFDGKPLASVARGDLDLGALNDDEKKAQEETGEAMKPVVDKMKETLGEKVKDVRVTFRLTDSPSCLVADDNDMSGYLQRMLKAAG------QSAPSFQPILEINPEHPLVKALK 588          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_MYCBP7.951e-2834.39Chaperone protein htpG OS=Mycobacterium bovis (str... [more]
HTPG_MYCBO7.951e-2834.39Chaperone protein htpG OS=Mycobacterium bovis GN=h... [more]
HTPG_BURPS7.951e-2834.60Chaperone protein htpG OS=Burkholderia pseudomalle... [more]
HTPG_BURP17.951e-2834.60Chaperone protein htpG OS=Burkholderia pseudomalle... [more]
HTPG_BURMS7.951e-2834.60Chaperone protein htpG OS=Burkholderia mallei (str... [more]
HTPG_BURMA7.951e-2834.60Chaperone protein htpG OS=Burkholderia mallei GN=h... [more]
HTPG_BURM97.951e-2834.60Chaperone protein htpG OS=Burkholderia mallei (str... [more]
HTPG_BURM77.951e-2834.60Chaperone protein htpG OS=Burkholderia mallei (str... [more]
HTPG_IDILO1.356e-2734.26Chaperone protein htpG OS=Idiomarina loihiensis GN... [more]
HTPG_BURP01.356e-2734.12Chaperone protein htpG OS=Burkholderia pseudomalle... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top