FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_POLNA (Chaperone protein htpG OS=Polaromonas naphthalenivorans (strain CJ2) GN=htpG PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.558e-26
Identity = 72/215 (33.49%), Postives = 112/215 (52.09%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYM--SSKKTMEINPENPIMEELRKRAD 637
            F   LK G+ ED  N+ +LA+LLR+ S+ +     S  DY  RMK+GQ+ IYYIT ++  A ++SP LE  +KKG EVL M D +DE+A+  L EF+G  L S  K  + L   + EDEKK  E  + +F+ +   +K+ L                P CLV  +   +  + R++K         AG      K  +E+N ++P++ +L   ++
Sbjct:  385 FGAVLKEGLGEDFANRERLAKLLRFASSTTDTTTVSFADYKARMKDGQDAIYYITADTLAAAKSSPQLEIFRKKGIEVLLMADRVDEWALNYLNEFDGTPLQSVAKGAVDLGKLQDEDEKKAAEEAQTQFKPILDKLKEALKDKASDVRATSRLVDSPACLVVQDGDMSTQLARMLK--------QAGQTVPEVKPILEVNAQHPLVRKLEASSE 591          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HAES1 (Chaperone protein htpG OS=Haemophilus somnus (strain 129Pt) GN=htpG PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.558e-26
Identity = 77/217 (35.48%), Postives = 113/217 (52.07%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEK-FEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  NK  +A+LLR+ S+K  S ++  SL+DYV RMKEGQ  IYYIT +S  A +NSP LE   KK  EVL + D IDE+ +  L EF+GK+L   TK  L L +  D+++ ++  ++K F    + +K +LG               P  + T     T  M ++  A              K T E+NPE+ +++++   AD D+
Sbjct:  381 FGLVLKEGPSEDFANKENIAKLLRFASSKNDSSEQTVSLEDYVARMKEGQKAIYYITADSYIAAKNSPHLELFNKKDIEVLLLSDRIDEWMLSYLTEFDGKQLQPITKADLDLGDLADKEQEEQKEQDKTFSSFIERVKTLLGERVKDVRLTHRLTDTPAVVSTDNDQMTTQMAKLFAAAG------QPVPEVKYTFELNPEHHLVKKVADLADEDE 591          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_COLP3 (Chaperone protein htpG OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=htpG PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.558e-26
Identity = 77/219 (35.16%), Postives = 118/219 (53.88%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESED--EKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKA--QALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK G  ED  NK ++A LLR+ ST   S  +  SL  Y+ RMKEGQ+ IY++  +S +A +NSP LE  +KKG EVL M D IDE+ V  L EF+GK+L S T+ GL L + +D   K+ +E L+++++ + K IK  L                P C+V  +   ++ M ++M +  Q + D        +    EIN E+ +++ +    D D
Sbjct:  403 FGQVLKEGPAEDHANKEQVAGLLRFASTHEDSTTQNVSLASYIERMKEGQDKIYFVVADSFEAAKNSPHLEVFRKKGIEVLLMSDRIDEWLVSHLTEFDGKQLQSVTRGGLDLGDMDDAETKEAQEKLEKEYDSVVKRIKASLDGKVKEVKLSQRLTDSPACIVADDDDMSSQMAKLMASVGQEVPD--------TLPIFEINGEHALVKHVADEQDDD 613          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HAES2 (Chaperone protein htpG OS=Haemophilus somnus (strain 2336) GN=htpG PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.340e-26
Identity = 77/217 (35.48%), Postives = 113/217 (52.07%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEK-FEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  NK  +A+LLR+ S+K  S ++  SL+DYV RMKEGQ  IYYIT +S  A +NSP LE   KK  EVL + D IDE+ +  L EF+GK+L   TK  L L +  D+++ ++  ++K F    + +K +LG               P  + T     T  M ++  A              K T E+NPE+ +++++   AD D+
Sbjct:  381 FGLVLKEGPSEDFANKENIAKLLRFASSKNDSSEQTVSLEDYVARMKEGQKAIYYITADSYIAAKNSPHLELFNKKDIEVLLLSDRIDEWMLSYLTEFDGKQLQPITKADLDLGDLADKEQEEQKEQDKTFSSFIERVKTLLGERVKDVRLTHRLTDTPAVVSTDNDQMTTQMAKLFAAAG------QPVPEVKYTFELNPEHHLVKKVADFADEDE 591          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_AGGAC (Chaperone protein htpG OS=Aggregatibacter actinomycetemcomitans GN=htpG PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.363e-26
Identity = 79/214 (36.92%), Postives = 110/214 (51.40%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ ST   S ++  SL+DYV+RMKEGQ  IYYIT +S  A  NSP LE   KKG EVL + D IDE+ +  L EF+GK L S TK  L L D ++ E + ++   E F    + +K +LG               P  + T     T  M ++  A              K T E+NPE+ +++++ + AD
Sbjct:  381 FGLVLKEGPAEDFANKEAIAKLLRFASTHNDSSEQNVSLEDYVSRMKEGQKAIYYITADSYVAARNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKPLQSITKADLDLGDLADKEAEEQKAQDESFGSFVERVKTLLGGRVKEVRLTHRLTDTPAVVSTDNDQMTTQMAKLFAAAG------QPVPEVKYTFELNPEHHLVKKVAEIAD 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RALEH (Chaperone protein htpG OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=htpG PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.442e-26
Identity = 72/217 (33.18%), Postives = 118/217 (54.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            F + LK GI ED  N  ++A+LLR+ ST +   ++  +L  YV RMKEGQ+ IYY+T ++  A +NSP LE  +KKG EVL + D +DE+ +  L+EF+GK+LVS  +  L L +   E EK  +E  +  ++ +    K VL                  CLV+ E   +  ++R++K    +         ++  +E+NPE+ ++++LR   + D
Sbjct:  387 FGQALKEGIGEDQANLERVAKLLRFASTHNDTAEQNVALAAYVGRMKEGQDKIYYVTADTWSAAKNSPHLEVFRKKGIEVLLLTDRVDEWMLSFLREFDGKELVSVARGDLDLGKLADEAEKAEQEKAEADWKDVVDRAKTVLDGKAKDVRVTLRLTASASCLVSDEGDMSGYLQRLLKQAGQK------APDAQPILELNPEHALVQKLRDLPEGD 597          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HAEIN (Chaperone protein htpG OS=Haemophilus influenzae GN=htpG PE=3 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 7.442e-26
Identity = 77/214 (35.98%), Postives = 111/214 (51.87%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ ST +   ++  SL+DY+ RMKEGQ  IYYIT +S  A +NSP LE   KKG EVL + D IDE+ +  L EF+GK+L S TK  L L D ++ E + ++   E F    + +K++LG               P  + T     T  M ++  A              K T E+NPE+ +++++   AD
Sbjct:  381 FGLVLKEGPAEDFANKETVAKLLRFASTHNDGSEQTVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQQDEAFGSFIERVKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAG------QPVPEVKYTFELNPEHHLVKKVADIAD 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HAEIG (Chaperone protein htpG OS=Haemophilus influenzae (strain PittGG) GN=htpG PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.442e-26
Identity = 77/214 (35.98%), Postives = 111/214 (51.87%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ ST +   ++  SL+DY+ RMKEGQ  IYYIT +S  A +NSP LE   KKG EVL + D IDE+ +  L EF+GK+L S TK  L L D ++ E + ++   E F    + +K++LG               P  + T     T  M ++  A              K T E+NPE+ +++++   AD
Sbjct:  381 FGLVLKEGPAEDFANKETIAKLLRFASTHNDGCEQTVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQRDEAFGSFIERVKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAG------QPVPEVKYTFELNPEHHLVKKVADIAD 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HAEIE (Chaperone protein htpG OS=Haemophilus influenzae (strain PittEE) GN=htpG PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.442e-26
Identity = 77/214 (35.98%), Postives = 111/214 (51.87%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKS--GDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  NK  +A+LLR+ ST +   ++  SL+DY+ RMKEGQ  IYYIT +S  A +NSP LE   KKG EVL + D IDE+ +  L EF+GK+L S TK  L L D ++ E + ++   E F    + +K++LG               P  + T     T  M ++  A              K T E+NPE+ +++++   AD
Sbjct:  381 FGLVLKEGPTEDFANKETVAKLLRFASTHNDGSEQAVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGIEVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQQDEAFGSFIERVKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAG------QPVPEVKYTFELNPEHHLVKKVADIAD 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_POLSJ (Chaperone protein htpG OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=htpG PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.719e-26
Identity = 71/210 (33.81%), Postives = 111/210 (52.86%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMK--AQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            F   LK G+ ED  N+ +LA+LLR+ S+ +        DY  RMKEGQ+ IYY+T ++  A ++SP LE  +KKG EVL M D +DE+A+  L EF+G  L S  K  + L   + EDEKK  E  +  F+ +   +K+ L                P CLV  +   +  + R++K   QA+ +         K  +E+N ++P++++L
Sbjct:  385 FGAVLKEGLGEDFANRERLAKLLRFASSTTDTVSVGFADYKARMKEGQDAIYYVTADTLAAAKSSPQLEIFRKKGIEVLLMADRVDEWALNYLHEFDGTPLQSVAKGAVDLGKLQDEDEKKAAEEAQTHFKPILDKLKEALKDKAKDVRATTRLVDSPACLVVQDGDMSTQLARMLKQAGQAVPE--------VKPILEVNAQHPLVKKL 586          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_POLNA2.558e-2633.49Chaperone protein htpG OS=Polaromonas naphthaleniv... [more]
HTPG_HAES12.558e-2635.48Chaperone protein htpG OS=Haemophilus somnus (stra... [more]
HTPG_COLP32.558e-2635.16Chaperone protein htpG OS=Colwellia psychrerythrae... [more]
HTPG_HAES23.340e-2635.48Chaperone protein htpG OS=Haemophilus somnus (stra... [more]
HTPG_AGGAC4.363e-2636.92Chaperone protein htpG OS=Aggregatibacter actinomy... [more]
HTPG_RALEH7.442e-2633.18Chaperone protein htpG OS=Ralstonia eutropha (stra... [more]
HTPG_HAEIN7.442e-2635.98Chaperone protein htpG OS=Haemophilus influenzae G... [more]
HTPG_HAEIG7.442e-2635.98Chaperone protein htpG OS=Haemophilus influenzae (... [more]
HTPG_HAEIE7.442e-2635.98Chaperone protein htpG OS=Haemophilus influenzae (... [more]
HTPG_POLSJ9.719e-2633.81Chaperone protein htpG OS=Polaromonas sp. (strain ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top