FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SODGM (Chaperone protein htpG OS=Sodalis glossinidius (strain morsitans) GN=htpG PE=3 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 4.992e-22
Identity = 73/214 (34.11%), Postives = 103/214 (48.13%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEK-FEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED TN   +A+LLR+ ST   S  +  SL++YV RM EGQ  IYYIT +S  A ++SP LE L+KKG EVL   D IDE+ +  L EF+GK   S +K    LD+  DE+  ++   EK  E   + +K  LG               P  + T     T  M ++  A       +      K   E+NP++ +++      D
Sbjct:  382 FGLVLKEGAGEDPTNGEAVAKLLRFASTHGDSPAQTVSLEEYVGRMVEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLFSDRIDEWMMSYLTEFDGKAFQSVSKADPSLDKLADEEDEEQKEVEKALEPFVERVKTYLGERVKEVRLTHRLTDTPAVVTTDADDMTTQMAKLFAAAGQAAPEI------KYIFELNPDHALVKRTANLGD 589          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHISS (Chaperone protein htpG OS=Shigella sonnei (strain Ss046) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHIFL (Chaperone protein htpG OS=Shigella flexneri GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTYTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHIDS (Chaperone protein htpG OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_SHIBS (Chaperone protein htpG OS=Shigella boydii serotype 4 (strain Sb227) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICBR (Chaperone protein htpG OS=Rickettsia bellii (strain RML369-C) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 69/227 (30.40%), Postives = 117/227 (51.54%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLK--EKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRK--RADADKNDKSVK 664
            +F   LK G+ E +T+  KL E+  + S    +++ SL +Y+   KEGQN IYY++G++   + +SP +E L  K  +VL   D +D++ V    E++G  + SAT+  + +D+  S  E+K K+  K  ++++ L    K+VLG               P CL   E      MER +  Q    N      +S K +E+NP+N I+E++    +A+   N++ VK
Sbjct:  369 NFGGALKEGLCEATTDHEKLLEVCIFRSALH-NKMISLDEYIKGFKEGQNTIYYLSGDNPDKLLSSPQIEGLLSKNIDVLLFTDTVDDFWVNVNSEYKGHTIKSATRSDIDVDQATSSSEEKNKDDKKSDDEYKSLTDYFKEVLGILVKDVKISKKLTSSPACLAVSEAAMDIRMERFLIEQKQIAN------ASAKNLELNPKNKIIEKIFNDLKANNKNNEELVK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICB8 (Chaperone protein htpG OS=Rickettsia bellii (strain OSU 85-389) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 69/227 (30.40%), Postives = 117/227 (51.54%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLK--EKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRK--RADADKNDKSVK 664
            +F   LK G+ E +T+  KL E+  + S    +++ SL +Y+   KEGQN IYY++G++   + +SP +E L  K  +VL   D +D++ V    E++G  + SAT+  + +D+  S  E+K K+  K  ++++ L    K+VLG               P CL   E      MER +  Q    N      +S K +E+NP+N I+E++    +A+   N++ VK
Sbjct:  369 NFGGALKEGLCEATTDHEKLLEVCIFRSALH-NKMISLDEYIKGFKEGQNTIYYLSGDNPDKLLSSPQIEGLLSKNIDVLLFTDTVDDFWVNVNSEYKGHAIKSATRSDIDVDQATSSSEEKNKDDKKSDDEYKSLTDYFKEVLGILVKDVKISKKLTSSPACLAVSEAAMDIRMERFLIEQKQIAN------ASAKNLELNPKNKIIEKIFNDLKANNKNNEELVK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOUT (Chaperone protein htpG OS=Escherichia coli (strain UTI89 / UPEC) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOLI (Chaperone protein htpG OS=Escherichia coli (strain K12) GN=htpG PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOLC (Chaperone protein htpG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_SODGM4.992e-2234.11Chaperone protein htpG OS=Sodalis glossinidius (st... [more]
HTPG_SHISS6.519e-2234.25Chaperone protein htpG OS=Shigella sonnei (strain ... [more]
HTPG_SHIFL6.519e-2234.25Chaperone protein htpG OS=Shigella flexneri GN=htp... [more]
HTPG_SHIDS6.519e-2234.25Chaperone protein htpG OS=Shigella dysenteriae ser... [more]
HTPG_SHIBS6.519e-2234.25Chaperone protein htpG OS=Shigella boydii serotype... [more]
HTPG_RICBR6.519e-2230.40Chaperone protein htpG OS=Rickettsia bellii (strai... [more]
HTPG_RICB86.519e-2230.40Chaperone protein htpG OS=Rickettsia bellii (strai... [more]
HTPG_ECOUT6.519e-2234.25Chaperone protein htpG OS=Escherichia coli (strain... [more]
HTPG_ECOLI6.519e-2234.25Chaperone protein htpG OS=Escherichia coli (strain... [more]
HTPG_ECOLC6.519e-2234.25Chaperone protein htpG OS=Escherichia coli (strain... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top