FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOL6 (Chaperone protein htpG OS=Escherichia coli O6 GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOL5 (Chaperone protein htpG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOK1 (Chaperone protein htpG OS=Escherichia coli O1:K1 / APEC GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECOHS (Chaperone protein htpG OS=Escherichia coli O9:H4 (strain HS) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECO57 (Chaperone protein htpG OS=Escherichia coli O157:H7 GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ECO24 (Chaperone protein htpG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=htpG PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.519e-22
Identity = 75/219 (34.25%), Postives = 109/219 (49.77%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHST--KSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI---KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F   LK G  ED  N+  +A+LLR+ ST   S  +  SL+DYV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L   I   K +LG               P  + T     +  M ++  A   +   +      K   E+NP++ +++      D  K
Sbjct:  378 FGLVLKEGPAEDFANQEAIAKLLRFASTYTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADE--VDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEV------KYIFELNPDHVLVKRAADTEDEAK 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NATTJ (Chaperone protein htpG OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=htpG PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.515e-22
Identity = 66/217 (30.41%), Postives = 118/217 (54.38%), Query Frame = 2
Query:    2 SFSKNLKLGIHED-STNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKN 649
            SF   LK GI+ +   NK  L +LL ++S+K  +++ SL +Y++RM E Q  IYY TGES + ++  P  E +K KGYEVLY+ + +DE+A+  +  ++  +  S + + L LD SEDE+   E  KE ++G+   + ++L                P CL   E   +  ME+++++     N     + ++K +EIN  + + ++L +  + D++
Sbjct:  384 SFGTLLKYGIYSEFGQNKETLQDLLLFYSSKE-NKMVSLDEYISRMGEDQKYIYYATGESVERIDKLPQTEFVKDKGYEVLYLTEDVDEFAIKMMGSYQDVEFKSVSSKDLGLD-SEDEETSDEKEKE-YKGMFDKMAEILSDKVNTVRASERLKDHPVCL-ANEGEISIEMEKVLQSMPNNQN-----VQAEKALEINVNHDVFDKLTEAYEQDED 591          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_KLEP7 (Chaperone protein htpG OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=htpG PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.515e-22
Identity = 78/221 (35.29%), Postives = 111/221 (50.23%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKE---KFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            F   LK G  ED +N+  +A+LLR+ +T   S  +  SL++YV+RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S  K    LD+  DE  + E+ KE     E   + +K++LG               P  + T     +  M ++  A       +      K   E+NP +    +L KRA AD  D
Sbjct:  378 FGLVLKEGPAEDPSNQEAIAKLLRFATTHTDSSAQTVSLEEYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMSYLTEFDGKAFQSVAKADESLDKLADE--VDESTKEAEKALEPFVERVKNLLGDRVKEVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQAAPEV------KYIFELNPAH----QLVKRA-ADTQD 585          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BACHD (Chaperone protein htpG OS=Bacillus halodurans GN=htpG PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.515e-22
Identity = 69/219 (31.51%), Postives = 113/219 (51.60%), Query Frame = 2
Query:    2 SFSKNLKLGIHED-STNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKL--VSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKN 649
            SF + LK G++ D   NK  L +LL ++S+    ++ +L +YV+RMKE Q  IYY TGES   +E  P  E +  KGYE+LY  + +DE+A+  L  ++ K+   VS+   G + DE +D     +  KE FE +    K +L                P CL T E   +  ME++++A     N     + ++K +EIN  + + + L+   ++DK+
Sbjct:  382 SFGRQLKYGVYSDFGANKEDLQDLLLFYSSTE-KKMVTLDEYVSRMKEDQPYIYYATGESYARIEKLPQTEMVADKGYEILYFTEDVDEFAIKMLASYKEKEFRSVSSGDLGFEDDEQKDTAADTDEQKELFEHM----KTILDGKVKDVRASKRLKSHPVCL-TAEGEVSIEMEKVLRAMPDNQN-----VQAEKVLEINVNHDVFDVLKASFESDKD 589          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BORGA (Chaperone protein htpG OS=Borrelia garinii GN=htpG PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.112e-21
Identity = 65/217 (29.95%), Postives = 111/217 (51.15%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            F + +K G++ D  N+ KL  L+R+ S+ S D   S K+Y  RMKE Q  IYYITG  +  ++ +P +   K+KG+E+L M D +DE  +  + E+EG KL +  K     +E +DE   K  ++E+F+ +   +K++L                P  ++      T  M++IM +       +      K  +E+NP N I++ L K  +++K +K
Sbjct:  375 FGRCIKEGVYSDFENREKLISLIRFKSS-SVDGFVSFKEYKERMKESQKSIYYITGGKENILKENPIVSAYKEKGFEILIMDDELDEAILNLIPEYEGLKLKAINKNETS-NELKDENFKK--IEEEFKDILTKVKEILKDHIKEVNLSATLIKEPSAIIVDSNDPTYQMQKIMLSMGQEVKEI------KPILELNPNNKIVQNL-KNLESEKLEK 580          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_ECOL66.519e-2234.25Chaperone protein htpG OS=Escherichia coli O6 GN=h... [more]
HTPG_ECOL56.519e-2234.25Chaperone protein htpG OS=Escherichia coli O6:K15:... [more]
HTPG_ECOK16.519e-2234.25Chaperone protein htpG OS=Escherichia coli O1:K1 /... [more]
HTPG_ECOHS6.519e-2234.25Chaperone protein htpG OS=Escherichia coli O9:H4 (... [more]
HTPG_ECO576.519e-2234.25Chaperone protein htpG OS=Escherichia coli O157:H7... [more]
HTPG_ECO246.519e-2234.25Chaperone protein htpG OS=Escherichia coli O139:H2... [more]
HTPG_NATTJ8.515e-2230.41Chaperone protein htpG OS=Natranaerobius thermophi... [more]
HTPG_KLEP78.515e-2235.29Chaperone protein htpG OS=Klebsiella pneumoniae su... [more]
HTPG_BACHD8.515e-2231.51Chaperone protein htpG OS=Bacillus halodurans GN=h... [more]
HTPG_BORGA1.112e-2129.95Chaperone protein htpG OS=Borrelia garinii GN=htpG... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top