FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_CITK8 (Chaperone protein htpG OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=htpG PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.897e-21
Identity = 71/216 (32.87%), Postives = 107/216 (49.54%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTK--SGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGL---CKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRAD 637
            F   LK G  ED  N+  +A+L+R+ ST   S  +  SL+DY++RMKEGQ  IYYIT +S  A ++SP LE L+KKG EVL + D IDE+ +  L EF+GK   S +K    L++  DE  + E+ KE  + L    + +K +LG               P  + T     +  M ++  A              K   E+NP++ +++      D
Sbjct:  378 FGLVLKEGPAEDHANQEAIAKLMRFASTHTDSSAQTVSLEDYISRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKAFQSVSKVDESLEKLADE--VDESAKEAEKALTPFVERVKTLLGDRVKEVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAG------QAVPEVKYIFELNPDHVLVKRTADTQD 585          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_CHLPD (Chaperone protein htpG OS=Chlorobium phaeobacteroides (strain DSM 266) GN=htpG PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.897e-21
Identity = 64/225 (28.44%), Postives = 118/225 (52.44%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGD-ELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEK---KMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVK 664
            +F   LK+G++ D T++ ++  L+R+ STK+ + E  + K+YV RM+ GQN+IYY +G ++  +   P LE  + KG EVL + D +D + +  + E++ K L S  K  +    + D+K    + ETL +   GL    +  +G               P  LV+G+    ++ME++MK         A   ++KK +E+N  +PI++ L     A++++  ++
Sbjct:  373 AFGPFLKIGLNTDFTHRDRIIGLMRFESTKTAEGEYVTFKEYVERMEAGQNEIYYHSGSNRIQLLAHPNLEYFQHKGIEVLLLSDPVDVFVIPSIHEYDKKPLKSIEKADIDFTRTGDDKTEPPLPETLSQPLLGL---FRQTIGDVIEDVVESHRLVSSPVTLVSGKDSLDSSMEKMMKMM------HAEMPAAKKILEVNTSHPIIKNLSGMIMANEHNPLIR 588          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_METRJ (Chaperone protein htpG OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=htpG PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.477e-21
Identity = 70/214 (32.71%), Postives = 108/214 (50.47%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADAD 643
            +F   LK GI+ED   + ++A LLR+ S+ + +  TSL DYV+RMK+GQ  IYY+  +  +A+++SP LE  + +G EVL + D +D +   QL  F+GK L S TK GL L +   E +  E   E  +     +K  LG                  L  G  G    M+R+M     R    AG  + +  +EINP +P++  L    +++
Sbjct:  366 NFGPVLKEGIYEDFERRGEIAPLLRFRSS-AVEGWTSLPDYVSRMKDGQEAIYYLVADDAEALKSSPQLEGFRARGLEVLLLSDHVDAFWPDQLGTFDGKPLRSITKGGLDLSKFALEGEQPEA-PEGIDAFVAAVKTALGAEVSDVRTTDRLVDSAVVLSAGSGGPDLQMQRLM-----RRAGRAG--AGQPVLEINPRHPLIRALAAAPESE 570          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_WOLPM (Chaperone protein htpG OS=Wolbachia pipientis wMel GN=htpG PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.236e-21
Identity = 74/250 (29.60%), Postives = 116/250 (46.40%), Query Frame = 2
Query:    2 SFSKNLKLGIHE--DSTNKTKLAELLRYHSTKSGDE-LTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKL-------DESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +F   LK G+ E   +  +  L  + R+HST  GDE L S+ DY++RMK  Q  IYY+TG S  +V+NSP LE    KG EVL  VD +D++    + E++ +K+ S T+  + L       D++++E K  E   E  E + +    VLG               P CL   E      MER      LR+     Y  + K +EIN ++P+++ + K       + +++D             G  +D
Sbjct:  378 NFGAVLKEGLCEAMPTDEREALLSICRFHST--GDEKLVSIDDYISRMKPEQEHIYYLTGNSLDSVKNSPQLEGFVSKGLEVLLFVDPVDDFWTSVIHEYKDQKIKSVTRADVDLEKFSSEEDKTDEENKSNEEKTE--ETILQYFTTVLGDSVKSVKISKKLTDSPVCLAVDEGAMDLRMERF-----LREQKQLNY-RTPKVLEINTKHPLIKSIMKSYAESGENPTLEDMIHLLFYQACIVEGEEMD 617          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BORAP (Chaperone protein htpG OS=Borrelia afzelii (strain PKo) GN=htpG PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.519e-21
Identity = 65/217 (29.95%), Postives = 109/217 (50.23%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDK 655
            F + +K G++ D  N+ KL  L+R+ S+ S D   S K+Y  RM EGQ  IYYITG  +  ++ +P +   K+KG+E+L M D +DE  +  + E+EG KL +  K     +E +DE   K  ++E+F+     +K++L                P  ++      T  M++IM +       +      K  +E+NP N I++ L K  + +K +K
Sbjct:  375 FGRCIKEGVYSDFENREKLISLIRFKSS-SVDGFVSFKEYKERMNEGQKSIYYITGGKENILKENPIVTAYKEKGFEILIMDDELDEAILNLIPEYEGLKLKAINKNETS-NELKDENFKK--IEEEFKDTLTRVKEILKDQIKEVNLSATLIKEPSAIIVDSNDPTYQMQKIMLSMGQEVKEI------KPILELNPNNKIVQNL-KNLEPEKLEK 580          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BACLD (Chaperone protein htpG OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=htpG PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.519e-21
Identity = 67/218 (30.73%), Postives = 115/218 (52.75%), Query Frame = 2
Query:    2 SFSKNLKLGIHED-STNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVL-GXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKN 649
            SF + LK G++ D   +K  L +LL ++S+K   +L +L++YV+RM E Q  IYY +G+S   +E  P  E + +KGYE+LY  + IDE+A+  L  ++ K+  S +   L + E++DE+   +    +++ L + +K  L G                C    GE   T  ME+I+   A+ DN    ++ + K +EIN  + + + L+   D DK+
Sbjct:  382 SFGRQLKFGVYNDFGAHKDLLKDLLLFYSSKE-KKLVTLEEYVSRMPEDQKYIYYASGDSYDRIEKLPQTELVSEKGYEILYFTEDIDEFAIKMLANYQEKEFKSVSSGDLGI-ENDDEQNQSDGDDSQYKDLFEEMKKTLDGKVKSVRASKRLKTHSVCLAADGEV--TIEMEKIL--NAMPDNQ---HVKADKVLEINTNHEVFKTLQNAFDNDKD 590          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_ALKMQ (Chaperone protein htpG OS=Alkaliphilus metalliredigens (strain QYMF) GN=htpG PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.519e-21
Identity = 63/216 (29.17%), Postives = 115/216 (53.24%), Query Frame = 2
Query:    2 SFSKNLKLGIHED-STNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            SF + +K G++ D   NK  L +LL ++S+K   ++ +L +YV RMKE Q  IYY +G+S + ++  P  E L ++GYE+LY  D +DE+A+  L +++ K+  S +   L ++E +DEK+ +E   +  + +   +K+ L                P CL T +   T  ME+I+ A           + +++ +EIN  + + + L++  D D+
Sbjct:  382 SFGRQIKYGVYSDFGQNKETLKDLLLFYSSKE-KKMVTLDEYVGRMKEDQKYIYYASGDSIEKIDKMPQTELLAEQGYEILYFADDVDEFAIRVLVDYKEKEFKSVSSGDLGIEE-KDEKEEQEEQTQGSKEVFAFMKEALSQKVKDVRPSKRLKNHPVCLAT-DGDVTIEMEKILSAMPNNQE-----IKAERVLEININHDVFKTLKEAFDNDQ 589          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICCK (Chaperone protein htpG OS=Rickettsia canadensis (strain McKiel) GN=htpG PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.208e-21
Identity = 65/225 (28.89%), Postives = 113/225 (50.22%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI----KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADA-DKNDKSV 661
            +F   LK G+ E +T+  KL E+  + S    +++ SL +Y+   KEGQN IYY++G++   + +SP +E L  K  +VL   D +D++ V    E++G  + SAT+  + ++++    + K T  +K +   K++    K+ LG               P CL   E      MER +  Q    N      +S K +E+NP+N I+E++     A +KN+K +
Sbjct:  369 NFGGALKEGLCESTTDHEKLLEVCIFRSALH-NKMISLDEYIANFKEGQNTIYYLSGDNPDKLLSSPQIEGLLSKNIDVLLFTDTVDDFWVNVNSEYKGHAIKSATRSDIDVEQTTSSSEEKNTDSKKSDDEYKLLTDYFKETLGDLVKDVKISKKLTSSPACLAVSESAMDIRMERFLIEQKQIAN------ASAKNLELNPKNKIIEKIFNDLKANNKNNKEL 586          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_WOLTR (Chaperone protein htpG OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=htpG PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.414e-21
Identity = 73/249 (29.32%), Postives = 119/249 (47.79%), Query Frame = 2
Query:    2 SFSKNLKLGIHE--DSTNKTKLAELLRYHSTKSGDE-LTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETL--KEKFEG----LCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSVKDXXXXXXXXXXXTSGXSLD 721
            +F   LK G+ E   +  +  L  + R+HST  GD+ L S+ DY++RMK  Q  IYY+TG S  +V+NSP LE    KG EVL  VD +D++    + E++G+K  S T+  + L++   E+K KE    +E+ EG    + +    VLG               P CL   E      MER      LR+ +   Y  + K +E+N ++ +++ + K    +  + +++D             G  +D
Sbjct:  379 NFGAVLKEGLCEAMPTEEREALLSICRFHST--GDKKLVSIDDYISRMKPEQGYIYYLTGNSLDSVKNSPQLEGFISKGLEVLLFVDPVDDFWTSVIHEYKGQKFKSVTRADVDLEKFSPEEKDKENKSDEERAEGNTDSILQYFTKVLGNAVKSVKISKKLTDSPVCLAVDEGAMDLRMERF-----LREQNQLNY-RTPKVLEVNTKHSVIKSIIKSYAENGENPTLEDMVHLLFYQACIVEGEEMD 619          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_HELPY (Chaperone protein htpG OS=Helicobacter pylori GN=htpG PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.414e-21
Identity = 71/218 (32.57%), Postives = 112/218 (51.38%), Query Frame = 2
Query:    5 FSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSAT-KEGLK---LDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            F K LK G++ D  NK KL ELLR++S K  ++L SLK+Y   +KE Q  IYY+ GE+   ++ SP LEK  +KGY+VL + D ID + +  + E++      A+  E LK   L+E  DE      +K++F+ L K  ++ L                    +T       + +  M A  +R    +    SKKT+E+NP + I+++L K  D ++
Sbjct:  382 FGKVLKEGLYGDFENKEKLLELLRFYS-KDKEKLISLKEYKENLKENQKSIYYLLGENLDLLKASPLLEKYAQKGYDVLLLSDEIDAFVMPGVNEYDKTPFKDASHSESLKELGLEEIHDE------VKDQFKDLMKAFEENLKDEIKGVELSSH--------LTSAVALIGDEQNAMMANWMRQMGQS-VPESKKTLELNPNHAILQKLLKCEDKEQ 583          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_CITK81.897e-2132.87Chaperone protein htpG OS=Citrobacter koseri (stra... [more]
HTPG_CHLPD1.897e-2128.44Chaperone protein htpG OS=Chlorobium phaeobacteroi... [more]
HTPG_METRJ2.477e-2132.71Chaperone protein htpG OS=Methylobacterium radioto... [more]
HTPG_WOLPM3.236e-2129.60Chaperone protein htpG OS=Wolbachia pipientis wMel... [more]
HTPG_BORAP5.519e-2129.95Chaperone protein htpG OS=Borrelia afzelii (strain... [more]
HTPG_BACLD5.519e-2130.73Chaperone protein htpG OS=Bacillus licheniformis (... [more]
HTPG_ALKMQ5.519e-2129.17Chaperone protein htpG OS=Alkaliphilus metalliredi... [more]
HTPG_RICCK7.208e-2128.89Chaperone protein htpG OS=Rickettsia canadensis (s... [more]
HTPG_WOLTR9.414e-2129.32Chaperone protein htpG OS=Wolbachia sp. subsp. Bru... [more]
HTPG_HELPY9.414e-2132.57Chaperone protein htpG OS=Helicobacter pylori GN=h... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top