FC931307

Overview
NameFC931307
Unique NameFC931307
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15313 contig Ccv1_Contig15313:26..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICRS (Chaperone protein htpG OS=Rickettsia rickettsii (strain Sheila Smith) GN=htpG PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.503e-18
Identity = 58/211 (27.49%), Postives = 106/211 (50.24%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI----KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            +F   LK G+ E +TN  KL E+  + S    +++ SL +Y+   KEGQ+ IYY++G++   + +SP +E L  K  +VL   D +D++ V    +++   + SAT+  + ++++  + + K T  +K +   K++    K+ LG               P CL   +      MER +  Q    N      +S K +E+NP+N I+E++
Sbjct:  369 NFGGALKEGLCEATTNHEKLLEVCIFRSALH-NKMISLDEYIANFKEGQSTIYYLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVEQTTSQSEAKNTDSKKSDDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDIRMERFLIEQKQIAN------ASAKNLELNPKNKIIEKI 572          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICRO (Chaperone protein htpG OS=Rickettsia rickettsii (strain Iowa) GN=htpG PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.503e-18
Identity = 58/211 (27.49%), Postives = 106/211 (50.24%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI----KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            +F   LK G+ E +TN  KL E+  + S    +++ SL +Y+   KEGQ+ IYY++G++   + +SP +E L  K  +VL   D +D++ V    +++   + SAT+  + ++++  + + K T  +K +   K++    K+ LG               P CL   +      MER +  Q    N      +S K +E+NP+N I+E++
Sbjct:  369 NFGGALKEGLCEATTNHEKLLEVCIFRSALH-NKMISLDEYIANFKEGQSTIYYLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVEQTTSQSEAKNTDSKKSDDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDIRMERFLIEQKQIAN------ASAKNLELNPKNKIIEKI 572          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_EXIS2 (Chaperone protein htpG OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=htpG PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.503e-18
Identity = 61/216 (28.24%), Postives = 107/216 (49.54%), Query Frame = 2
Query:    2 SFSKNLKLGIHED-STNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F + LK GI+ D    K  + +L+ +HS K   +L +L +YV  M E Q  IYY +GES   ++  P  E +K KG+++LY  + IDE+A+  L  ++GK+  S T   L ++++E + +  ET  E F    K +++VL                P C  T +   +  ME+I+KA     +     +++ K +E+N  + +   +      D+
Sbjct:  381 AFGRQLKFGIYNDYGMQKDTVKDLVLFHSAKE-KKLVTLAEYVAAMPEEQKYIYYASGESTDRLDKLPQSELVKDKGFDILYFTEEIDEFAIQMLLNYDGKEFKSVTSSDLGIEQTE-QAETTETQAEMF----KAMQEVLAGHVKEVKASTRLKSHPVCFAT-DGAVSIEMEKILKAMPNNQD-----VAAVKILELNTSHDVFRAIETAYAEDR 584          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_BUCCC (Chaperone protein htpG OS=Buchnera aphidicola subsp. Cinara cedri GN=htpG PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.503e-18
Identity = 65/209 (31.10%), Postives = 101/209 (48.33%), Query Frame = 2
Query:   17 LKLGIHEDSTNKTKLAELLRYHSTKSG--DELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETL---KEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRK 628
            +K GI EDS NKT L+ LLR+ S K G  ++  SL +Y+  MK+ Q  IY+IT +S K+  NSP LE  K+   +VL + + IDE+ +  L EF   K  S +    KLD++ D   +K+ +   K  F    +  K +L                P  ++T     +  M +I  A              K  +EINP +P+++++ K
Sbjct:  384 IKEGIAEDSENKTILSNLLRFSSIKKGNIEQTLSLNEYIKNMKKNQKKIYFITSDSYKSALNSPNLEIFKENDIDVLILSEKIDEWMMNYLTEFNNIKFQSVS----KLDDTIDSLLLKKNVSNEKNTFNEFIEKTKKILKNKVKDVKITYRLKNTPAIVLTDTNDMSTQMAKIFSAAG------QPIPKIKYILEINPLHPLIKKIEK 582          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RHOPS (Chaperone protein htpG OS=Rhodopseudomonas palustris (strain BisB5) GN=htpG PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.963e-18
Identity = 71/223 (31.84%), Postives = 108/223 (48.43%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGL------KLDESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKND 652
            +F   LK G++ED   + KL  L R+  T +  E  +L  YV  MKE Q +IYY+ G+S + ++++P LE    +G EVL + D +D +      +F GK L S ++  +      KLD  + + K  ET K     +  VIKD LG                 CLV G +G    +E+++     R N  A   ++K  +EIN  +P++  L   A ADK D
Sbjct:  375 AFGPVLKEGLYEDYERREKLLALARF--TTTAGEKRTLSQYVEAMKENQTEIYYLVGDSIERLKSNPKLESATARGIEVLLLTDGVDAFWTSGQLDFGGKPLKSLSQGDVNFDLIPKLDADKPDDKPDET-KADEATVIAVIKDALGERVSDVKASQRLTSSASCLVAGGFGPDRELEKML----ARANKGA---ATKPVLEINLGHPLVAALAD-AKADKAD 586          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICCN (Chaperone protein htpG OS=Rickettsia conorii GN=htpG PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.564e-18
Identity = 59/211 (27.96%), Postives = 108/211 (51.18%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLK--EKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            +F   LK G+ E +TN  KL E+  + S    +++ SL +Y+   KEGQ+ IYY++G++   + +SP +E L  K  +VL   D +D++ V    +++   + SAT+  + +++  S+ E+K  ++ K  ++++ L    K+ LG               P CL   +      MER +  Q    N      +S K +E+NP+N I+E++
Sbjct:  369 NFGGALKEGLCEATTNHEKLLEVCIFRSALH-NKMISLDEYIANFKEGQSTIYYLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVEQTTSQSEEKNTDSTKSNDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDIRMERFLIEQKQIAN------ASAKNLELNPKNKIIEKI 572          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RHORT (Chaperone protein htpG OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=htpG PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.564e-18
Identity = 63/219 (28.77%), Postives = 102/219 (46.58%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLD--------ESEDEKKMKETLKEKFEGLCKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRA 634
            +F   LK GI+ED   K  L  L R+ +T S D   SL+  + RMKEGQ+ +YYITG+   A+  SP +E    +G EVL + D IDE+ V  + +     L +  +    L+        +  D+ +       K + L   +K  LG               P CLV  E   + +++++     LR  +    +S  + +EINP + +++ L +RA
Sbjct:  370 NFGAVLKEGIYEDFERKEDLVALARFRTTAS-DTPVSLETVIGRMKEGQSALYYITGDDATALARSPQVEGFVARGVEVLLLTDPIDEFWVSAVPKVGDTALKAVAQGSADLERLALIDGKQPPDDAEHAPAETAKMDALIAAMKAALGTAVADVRVSARLTDSPVCLVAKEGAMSLHLQKL-----LRQANQGSELSGDRVLEINPRHALVKTLAERA 582          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_NITHX (Chaperone protein htpG OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=htpG PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.564e-18
Identity = 62/218 (28.44%), Postives = 98/218 (44.95%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCK---VIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADK 646
            +F    K GI++ +  +  +  L R+ +T     L SLKDYV  +K+ Q  IYY+ G+    +E SP LE  + +G EVL + D +D + V     FEGK   S T+    L          ETL+E    + +    +K  L                P CL+  E G    +E+I+    +    + G  +SK  +E+NP +P++  L    D D+
Sbjct:  384 AFGPMFKEGIYDAADRRDAILSLCRFRTTAGS--LRSLKDYVGALKDNQTSIYYLAGQDAARLEASPHLEGFRARGVEVLLLSDPVDSFWVTSAPSFEGKPFKSVTQGDTDLAAIPRVDASAETLQEVSASVTEFLAFLKTTLADLVSDVRSSERLTDSPVCLIAAESGPDRQLEKIL----VGVGQLTG--ASKPVLEVNPRHPLIASLAALGDGDR 593          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RICAH (Chaperone protein htpG OS=Rickettsia akari (strain Hartford) GN=htpG PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.348e-18
Identity = 58/211 (27.49%), Postives = 105/211 (49.76%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKMKETLKEKFEGLCKVI----KDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEEL 622
            +F   LK G+ E +T+  KL E+  + S    +++ SL +Y+   KE QN IYY++G++   + +SP +E L  K  +VL   D +D++ V    E++G  + SAT+  + ++++  + + K T  +K +   K++    K+ LG               P CL   +      MER +  Q           +S K +E+NP+N I+E++
Sbjct:  369 NFGGALKEGLCEATTDHEKLLEVCIFRSALH-NKMISLDEYIAGFKEEQNTIYYLSGDNPDKLLSSPQIEGLLSKNIDVLLFTDTVDDFWVNVNSEYKGHAIKSATRSDIDVEQTTSQSEDKNTHSKKSDDEYKLLTDYFKETLGKLVKEVKISKKLTSSPACLAVSDSAMDIRMERFLIEQKQIT------AASAKNLELNPKNKIIEKI 572          
BLAST of FC931307 vs. ExPASy Swiss-Prot
Match: HTPG_RHOPB (Chaperone protein htpG OS=Rhodopseudomonas palustris (strain BisB18) GN=htpG PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.348e-18
Identity = 70/223 (31.39%), Postives = 108/223 (48.43%), Query Frame = 2
Query:    2 SFSKNLKLGIHEDSTNKTKLAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDE--SEDEKKMKETLKEKFEGL-CKVIKDVLGXXXXXXXXXXXXXXXPCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPENPIMEELRKRADADKNDKSV 661
            +F   +K GI ED   + KL  L R+ +TK   E  +LK YV  +KE Q +IYY+ G+S + ++++P LE    +G EVL + D +D +      +F GK L S ++  +   +  + +E K ++   E  E L    IKD LG                 CLV G  G    +ER++  Q    N  A   +SK  +E+N  +PI+  + K   AD  D S+
Sbjct:  375 AFGLVIKEGIWEDYERRDKLLALSRFTTTKG--ENRTLKQYVEDLKENQTEIYYLVGDSIERLKSNPKLESAAARGIEVLLLTDPVDAFWTSAPLDFGGKPLKSLSQGDVDFGQIPTTEENKDEQAKPETDEALTIAAIKDALGDKVSDVRASQRLTASASCLVAGGLGPDRALERMLAQQ----NRGA---ASKPILEVNLRHPIVAAVAKANAADAADLSL 588          
The following BLAST results are available for this feature:
BLAST of FC931307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
HTPG_RICRS1.503e-1827.49Chaperone protein htpG OS=Rickettsia rickettsii (s... [more]
HTPG_RICRO1.503e-1827.49Chaperone protein htpG OS=Rickettsia rickettsii (s... [more]
HTPG_EXIS21.503e-1828.24Chaperone protein htpG OS=Exiguobacterium sibiricu... [more]
HTPG_BUCCC1.503e-1831.10Chaperone protein htpG OS=Buchnera aphidicola subs... [more]
HTPG_RHOPS1.963e-1831.84Chaperone protein htpG OS=Rhodopseudomonas palustr... [more]
HTPG_RICCN2.564e-1827.96Chaperone protein htpG OS=Rickettsia conorii GN=ht... [more]
HTPG_RHORT2.564e-1828.77Chaperone protein htpG OS=Rhodospirillum rubrum (s... [more]
HTPG_NITHX2.564e-1828.44Chaperone protein htpG OS=Nitrobacter hamburgensis... [more]
HTPG_RICAH3.348e-1827.49Chaperone protein htpG OS=Rickettsia akari (strain... [more]
HTPG_RHOPB3.348e-1831.39Chaperone protein htpG OS=Rhodopseudomonas palustr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G02EF PostHarvP1 Citrus clementina cDNA clone C34103G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931307 ID=FC931307|Name=FC931307|organism=Citrus clementina|type=EST|length=721bp
GTCATTCTCTAAGAACCTAAAGCTTGGTATCCACGAGGACTCCACCAACA
AGACCAAGCTTGCTGAGCTGCTCCGATACCATTCCACCAAGAGTGGTGAT
GAGTTGACTAGCTTGAAGGACTATGTGACCAGAATGAAGGAAGGCCAGAA
TGATATCTACTACATCACTGGTGAGAGCAAGAAGGCTGTTGAGAACTCCC
CATTTCTTGAGAAGCTCAAGAAGAAGGGCTATGAAGTGCTCTACATGGTT
GATGCCATAGATGAGTACGCTGTTGGTCAGCTCAAGGAGTTTGAGGGAAA
GAAGCTTGTCTCAGCGACCAAAGAAGGTCTCAAGCTTGATGAGAGTGAAG
ATGAGAAGAAGATGAAGGAAACCTTGAAGGAGAAATTTGAGGGTCTCTGC
AAGGTGATCAAGGATGTTTTGGGTGACAAGGTCGAGAAGGTTGTGGTGTC
TGACCGTGTTGTTGACTCACCCTGCTGTTTGGTGACTGGTGAGTATGGAT
GGACAGCCAACATGGAGAGGATCATGAAGGCTCAGGCCTTGAGAGACAAC
AGCATGGCTGGTTACATGTCCAGCAAGAAGACCATGGAGATCAATCCGGA
GAACCCCATCATGGAGGAGCTCAGGAAGAGGGCTGATGCGGACAAGAATG
ACAAGTCTGTGAAGGACCTTGTCCTTCTGCTCTTTGAGACTGCTCTCCTC
ACTTCTGGTTNCAGCCTTGAT
back to top