FC931309

Overview
NameFC931309
Unique NameFC931309
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_HUMAN (Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens GN=IDH2 PE=1 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 1.186e-60
Identity = 105/143 (73.43%), Postives = 126/143 (88.11%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTV 707
            R+KV  P+VEMDGDEMTRIIWQ IK+KLI P++D+ +KY+DLG+ NRD TDD+VT++SA AT KY+VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+C+NIPR+VPGW KPI IGRHA GDQY+ATD V
Sbjct:   43 RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFV 185          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_PIG (Isocitrate dehydrogenase [NADP], mitochondrial (Fragment) OS=Sus scrofa GN=IDH2 PE=1 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.643e-60
Identity = 104/144 (72.22%), Postives = 127/144 (88.19%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            R+KV  P+VEMDGDEMTRIIWQ IK+KLI P++D+ +KY+DLG+ NRD T+D+VT++SA AT KY+VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+C+NIPR+VPGW KPI IGRHA GDQY+ATD V+
Sbjct:   12 RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVV 155          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_BOVIN (Isocitrate dehydrogenase [NADP], mitochondrial OS=Bos taurus GN=IDH2 PE=1 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 2.643e-60
Identity = 104/144 (72.22%), Postives = 127/144 (88.19%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            R+KV  P+VEMDGDEMTRIIWQ IK+KLI P++D+ +KY+DLG+ NRD T+D+VT++SA AT KY+VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+C+NIPR+VPGW KPI IGRHA GDQY+ATD V+
Sbjct:   43 RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVV 186          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHH_YEAST (Isocitrate dehydrogenase [NADP] OS=Saccharomyces cerevisiae GN=IDP3 PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.004e-59
Identity = 106/147 (72.11%), Postives = 125/147 (85.03%), Query Frame = 3
Query:  273 IDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVIK 713
            + ++KV +PIVEMDGDE TR+IW++IK+KLI PYLD+D+KYYDL I  RD T+D+VT +S+ ATLKY VA+KCATITPDE RMKEF LK MW+SPNGTIRNIL GTVFREPI+   IPR+VP W+KPI IGRHAFGDQYRATD  IK
Sbjct:    1 MSKIKVVHPIVEMDGDEQTRVIWKLIKEKLILPYLDVDLKYYDLSIQERDRTNDQVTKDSSYATLKYGVAVKCATITPDEARMKEFNLKEMWKSPNGTIRNILGGTVFREPIIIPKIPRLVPHWEKPIIIGRHAFGDQYRATDIKIK 147          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_YEAST (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Saccharomyces cerevisiae GN=IDP2 PE=1 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 1.713e-59
Identity = 103/144 (71.53%), Postives = 124/144 (86.11%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            ++KV NPIVEMDGDE TRIIW +I+DKL+ PYLD+D+KYYDL +  RD T+D+VTV+SA ATLKY VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+   IPR+VP W+KPI IGRHAFGDQY+ATD ++
Sbjct:    3 KIKVANPIVEMDGDEQTRIIWHLIRDKLVLPYLDVDLKYYDLSVEYRDQTNDQVTVDSATATLKYGVAVKCATITPDEARVEEFHLKKMWKSPNGTIRNILGGTVFREPIIIPRIPRLVPQWEKPIIIGRHAFGDQYKATDVIV 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_SCHPO (Probable isocitrate dehydrogenase [NADP], mitochondrial OS=Schizosaccharomyces pombe GN=idp1 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.502e-59
Identity = 99/150 (66.00%), Postives = 128/150 (85.33%), Query Frame = 3
Query:  258 ASATGIDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTV 707
            AS+    ++ V+NP+VEMDGDEMTR+IW++I++KL+ PY+D+ + YYDLGI  RD T+D++TV++A+A LK +V IKCATITPDE R+KE+ LK MW+SPNGTIRNILNGTVFREPIL +NIP+ +PGW  PICIGRHAFGDQY++TD V
Sbjct:    6 ASSKSFQKITVKNPVVEMDGDEMTRVIWKIIREKLVLPYMDIKLDYYDLGIEARDKTNDQITVDAAKAILKNDVGIKCATITPDEARVKEYNLKKMWKSPNGTIRNILNGTVFREPILIKNIPKYIPGWTNPICIGRHAFGDQYKSTDLV 155          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_DICDI (Isocitrate dehydrogenase [NADP], mitochondrial OS=Dictyostelium discoideum GN=idhM PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.603e-57
Identity = 98/144 (68.06%), Postives = 123/144 (85.42%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            R+KV  P+VEMDGDE TRI+W+ IK KLIFPY+D+  +YYDLG+ NRDAT+D+VT+++A A  +  + +KCATITPDE R+KEFGLK MW+SPNGTIRNIL+GTVFR PI+C+N+P +VPGWKKPI IGRHA GDQY+ATD V+
Sbjct:   26 RIKVTGPVVEMDGDEQTRIMWESIKSKLIFPYVDITPEYYDLGLPNRDATNDQVTIDAANAIKRAKIGVKCATITPDEARVKEFGLKEMWKSPNGTIRNILDGTVFRGPIICKNLPLLVPGWKKPIIIGRHAHGDQYKATDFVV 169          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_YEAST (Isocitrate dehydrogenase [NADP], mitochondrial OS=Saccharomyces cerevisiae GN=IDP1 PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.094e-57
Identity = 104/159 (65.41%), Postives = 127/159 (79.87%), Query Frame = 3
Query:  240 MSFRCFASA--TGIDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            +S R F+++      ++KV+ P+VE+DGDEMTRIIW  IK KLI PYLD+D+KYYDL + +RDAT DK+T ++AEA  KY V IKCATITPDE R+KEF L  MW+SPNGTIRNIL GTVFREPI+   IPR+VP W+KPI IGRHA GDQY+ATDT+I
Sbjct:    4 LSRRLFSTSRLAAFSKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEARVKEFNLHKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLI 162          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDH_MYCTU (Isocitrate dehydrogenase [NADP] OS=Mycobacterium tuberculosis GN=icd PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-56
Identity = 97/141 (68.79%), Postives = 120/141 (85.11%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATD 701
            ++KV  P+VE+DGDEMTR+IW++IKD LI PYLD+ + YYDLGI +RDATDD+VT+++A A  K+ V +KCATITPDE R++EF LK MW SPNGTIRNIL GT+FREPI+  N+PR+VPGW KPI IGRHAFGDQYRAT+
Sbjct:    6 KIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATN 146          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDH_MYCBO (Isocitrate dehydrogenase [NADP] OS=Mycobacterium bovis GN=icd PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-56
Identity = 97/141 (68.79%), Postives = 120/141 (85.11%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATD 701
            ++KV  P+VE+DGDEMTR+IW++IKD LI PYLD+ + YYDLGI +RDATDD+VT+++A A  K+ V +KCATITPDE R++EF LK MW SPNGTIRNIL GT+FREPI+  N+PR+VPGW KPI IGRHAFGDQYRAT+
Sbjct:    6 KIKVSGPVVELDGDEMTRVIWKLIKDMLILPYLDIRLDYYDLGIEHRDATDDQVTIDAAYAIKKHGVGVKCATITPDEARVEEFNLKKMWLSPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATN 146          
The following BLAST results are available for this feature:
BLAST of FC931309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
IDHP_HUMAN1.186e-6073.43Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDHP_PIG2.643e-6072.22Isocitrate dehydrogenase [NADP], mitochondrial (Fr... [more]
IDHP_BOVIN2.643e-6072.22Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDHH_YEAST1.004e-5972.11Isocitrate dehydrogenase [NADP] OS=Saccharomyces c... [more]
IDHC_YEAST1.713e-5971.53Isocitrate dehydrogenase [NADP] cytoplasmic OS=Sac... [more]
IDHP_SCHPO8.502e-5966.00Probable isocitrate dehydrogenase [NADP], mitochon... [more]
IDHP_DICDI1.603e-5768.06Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDHP_YEAST2.094e-5765.41Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDH_MYCTU1.357e-5668.79Isocitrate dehydrogenase [NADP] OS=Mycobacterium t... [more]
IDH_MYCBO1.357e-5668.79Isocitrate dehydrogenase [NADP] OS=Mycobacterium b... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G04EF PostHarvP1 Citrus clementina cDNA clone C34103G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931309 ID=FC931309|Name=FC931309|organism=Citrus clementina|type=EST|length=715bp
GACGGCGTCTTAATTTAAACGCCTATTATCATTCCCAAATGCTCAGGCTC
ATCAATAGTAGTTGTGGCAGTTTACGATCAAGCGTCATGTCATCTGCTGC
TGCCACCACCAAAATGATGTCATCGTCAACCGTCGCCGTTAAAAACCCCA
GATGGTCACTCTCTTCTTCAAACAATTCCGGTTTATTCAGCGGATATGTG
AACAATCGTGTGTCGTTTCGGAACCAGCTGGCTCCTGCGATGTCGTTTCG
GTGTTTTGCTAGTGCCACGGGGATTGATAGAGTCAAGGTTCAGAATCCTA
TCGTTGAAATGGACGGCGATGAGATGACGAGGATTATTTGGCAGATGATA
AAAGACAAACTCATTTTTCCTTACTTAGATTTGGATATAAAGTATTATGA
CTTGGGGATATTGAATCGTGATGCAACTGATGACAAGGTTACCGTAGAAA
GCGCTGAAGCAACTCTAAAGTACAATGTTGCCATCAAATGTGCCACAATA
ACTCCTGATGAGACCAGAATGAAGGAGTTTGGGCTGAAGTCAATGTGGAG
AAGTCCCAATGGCACAATTAGAAACATTTTAAATGGTACTGTTTTCCGTG
AACCCATCCTATGCCAGAATATTCCTAGAATAGTTCCTGGTTGGAAGAAA
CCTATATGTATTGGTAGGCATGCCTTTGGTGATCAGTATCGTGCTACTGA
TACAGTCATTAAGGG
back to top