FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C78A4_PINRA (Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.343e-11
Identity = 45/160 (28.12%), Postives = 83/160 (51.88%), Query Frame = 3
Query:  162 PGPTPYPVIGNLLELG-DKPHKSLAKLAKIHGP--IMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFG--MPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            PGP  +P+IG+L+++    PH+ L  LA++HG   +MS   G    V+ S   +A+E+L +    F NR +  +        FG  + + P    WR LR+I ++H F+ R++ A++  R+  +  +L  +Q+   +   + + +   G  LN I  ++F
Sbjct:   80 PGPKGWPIIGSLMDMSVGLPHRKLESLARLHGAKQLMSFSLGCTPAVITSDPEVARELLTSPH--FANRPLKQSAQ---QLLFGRAIGFAPNGGYWRLLRRIASAHLFAPRRIAAHEAGRQADVVAMLDDIQKEYHSKGVVRVRRHLQGAALNNIMGSVF 234          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: TCMO_GLYEC (Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.219e-11
Identity = 42/113 (37.17%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  153 RLPPGPTPYPVIGNLLELGDK-PHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRT---IPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSR 479
            +LPPGP P P+ GN L++GD   H++L  LAK  G I  L+ GQ   VV SS  +AKE+L  Q   F +RT   + D     G     M +      WR +R+I     F+++
Sbjct:   32 KLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQ---DMVFTVYGEHWRKMRRIMTVPFFTNK 141          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BF_ARATH (Cytochrome P450 71B15 OS=Arabidopsis thaliana GN=CYP71B15 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.219e-11
Identity = 43/180 (23.89%), Postives = 86/180 (47.78%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            +L+  +  F    K    +LPPGP   P+IGNL +      ++   LA+++GP+  L++G V  V  SS   A+E+L+  D   C+R     + A  ++   +   P    W  +RK+     FS ++L + +++  ++    +  + E     + +++ +A F    N++    + I+L
Sbjct:    9 VLLPLILIFLNVLKPSKYKLPPGPKKLPIIGNLHQRRTLHPRNRRNLAEMYGPVALLQYGFVPVVAISSKEAAEEVLKINDLECCSRPEAAGMRATFYNFKDIGMAPFGDEWSLMRKLSVVELFSVKKLQSFKYIIEEENNLCVKKLSEFATRQSPVNLERAIFTLVGNIVCRIGYGINL 188          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C78A4_PINRA2.343e-1128.13Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 P... [more]
TCMO_GLYEC5.219e-1137.17Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza ech... [more]
C71BF_ARATH5.219e-1123.89Cytochrome P450 71B15 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top