FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AM_ARATH (Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.819e-18
Identity = 51/196 (26.02%), Postives = 100/196 (51.02%), Query Frame = 3
Query:   63 MVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPT 650
            M S +  +L S I+ + + +F +  K      P  P   P+IGNL +LG  PH+SL  L+  +GP+M L+FG V  +V SSA +A++IL+  D  F +R          +    +   P    WR ++ +C  H  +++ + + +++R+++I  ++  +Q++  +   +++ +     T ++IS        +D T
Sbjct:    1 MESMIRIILLSLIIFITILFFIKQKKGKKSNTPASPPRLPLIGNLHQLGRHPHRSLCSLSNRYGPLMLLRFGLVPVLVVSSADVARDILKTYDRVFASRPRSKIFEKIFYEARDVALAPYGEYWRQMKSVCVLHLLTNKMVRSFRNVRQEEISLMMEKIQKS--SSLQVNLSELLGSLTNDVISRVALGRKYSDET 194          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71A9_SOYBN (Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.819e-18
Identity = 61/185 (32.97%), Postives = 98/185 (52.97%), Query Frame = 3
Query:  150 RRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFG--MPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL-------ADPTSKTAREFKQ 677
            R LPPGP   P IGNL +LG  PH+SL  L+  HGP+M L+ G + T+V SSA MA+EI +N D+ F  R    ++YA     +G  + + P    WR +RKI      S +++ + + +R ++++ LL   Q    +   +++ +     TL+L +N +  I L       AD  +K +   K+
Sbjct:   31 RLLPPGPRKLPFIGNLHQLGTLPHQSLQYLSNKHGPLMFLQLGSIPTLVVSSAEMAREIFKNHDSVFSGR---PSLYAANRLGYGSTVSFAPYGEYWREMRKIMILELLSPKRVQSFEAVRFEEVKLLL---QTIALSHGPVNLSE----LTLSLTNNIVCRIALGKRNRSGADDANKVSEMLKE 205          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71D6_SOLCH (Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.282e-17
Identity = 53/191 (27.75%), Postives = 100/191 (52.36%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            M ++S   ++ F ++L     Y      S +++LPPGP   P IG++  L G +PH+ L  LAK +GP+M L+ G+V+ VV +S  MAKE+L+  D +F +R    A+    +    + + P    W+ +RKIC +   S++ + +   +R  ++  L+  +Q +  +G  ++  +     T ++   + F
Sbjct:    1 MQLISIFLFICFLFLLRKWKKYSKN---SQTKKLPPGPWKLPFIGSMHHLAGGRPHRVLRDLAKKYGPLMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSAKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNFKERVIWFTSSMTCRSAF 188          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AQ_ARATH (Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.675e-17
Identity = 47/156 (30.13%), Postives = 85/156 (54.49%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQEN 548
            +LL S I VV +  F +  +   R   P P   P+IGNL +LG  PH+SL  L+  +GP+M L FG+V  +V SSA +A+++L+  D  F +R          + +  +   P    WR ++ +C  H FS++ + + + +R ++I  ++  ++++
Sbjct:    6 FLLCSIIFVVTIIIFRKQKRGKKRNTLPSPPGLPLIGNLHQLGRHPHRSLCSLSHRYGPLMLLHFGRVPVLVVSSAELARDVLKTHDRVFASRPRSKIFEKLLYDKHDVASAPYGEYWRQMKSVCVLHLFSNKMVRSFREVREEEISLMMEKIRKS 161          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C93A1_SOYBN (Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.187e-17
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  138 KSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFS-IDLADPTSKT---AREFKQQI 683
            K   + LPP P   P+IG+L  +   PH+   KL+  HGPIM L  G V  VV S+A  AKE L+  + +F NR    +     A+   +F   + P    W+ ++K+C S   S R +D    +R+++ +  ++ V     AG A+      FG  L  +SN I S + L+  TS+    A E K+ +
Sbjct:   23 KQSKKNLPPSPKALPIIGHLHLVSPIPHQDFYKLSTRHGPIMQLFLGSVPCVVASTAEAAKEFLKTHEINFSNRPGQNVAVKGLAYDSQDFLFAFAPFGPYWKFMKKLCMSELLSGRMMDQFLPVRQQETKRFISRVFRKGVAGEAVD-----FGDELMTLSNNIVSRMTLSQKTSENDNQAEEMKKLV 206          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B2_ARATH (Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 2.187e-17
Identity = 47/173 (27.17%), Postives = 92/173 (53.18%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLI 611
            +L +  + F +  K+    LPP P+  P+IGNL  L   PH+   KL+  +GP++ L+ G V  VV SS+  A+ +L+  D   C+R  T+     ++G  +  + + P    WR +RK+     FSS+++ + +++R +++  ++  V E+    + + + +  F  T ++I
Sbjct:   12 LLTIVSSIFLKQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRCFHKLSIKYGPLVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKD--ITFAPYGEYWREVRKLAVIELFSSKKVQSFRYIREEEVDFVVKKVSESALKQSPVDLSKTFFSLTASII 182          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.873e-17
Identity = 60/182 (32.97%), Postives = 87/182 (47.80%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH-GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            +  RRLPPGP  +PVIG L  LG  PH SLAK+AK +G IM LK G    VV S+   AK  L+  D +F NR  P+A   H  +    M +      W+ LRK+ N H    + L+   ++R  ++  +L  + +  R G  + + +       N+I   I S  +         EFK  +
Sbjct:   28 TNGRRLPPGPRGWPVIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMVVASTPDAAKAFLKTLDLNFSNRP-PNAGATHLAYGAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDMSREGERVVVAEMLTFAMANMIGQVILSKRVFVNKGVEVNEFKDMV 208          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71A6_NEPRA (Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.873e-17
Identity = 45/132 (34.09%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  159 PPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQE 545
            PP P   PV+GNL +LG  PH+SL  L++ +GP+M L FG V  +V SS   A+EI++NQD +F NR   +IP  +    H    + + P    WR +R IC     S++++ + + +R ++   ++  + +
Sbjct:   28 PPSPPKLPVLGNLHQLGTFPHRSLQSLSRRYGPVMQLHFGSVPVLVASSPEAAREIMKNQDLNFSNRPNLSIPRRLLYDNH---DVAFAPYGEYWRQIRSICVLQLLSNKRVQSFRRVREEETSIMVEKIMQ 156          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A4_GENTR (Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.365e-17
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 3
Query:   87 LFSWILVVALNYFSRGFKSGSR--RLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH-GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            LF +  V  L ++  G  +G R  RLPPGPT +P++G L  LG+ PH + A +AK +G +M LK G     + S+   AK  L+  D +F NR  P+A   H  ++   M +      W+ LRK+ N H    + L+    +R+ ++  +L  + E+ +    + I +       N++S  I S  + +     + EFK  +
Sbjct:   16 LFLFFHVQKLVHYLHGKATGHRCRRLPPGPTGWPILGALPLLGNMPHVTFANMAKKYGSVMYLKVGSHGLAIASTPDAAKAFLKTLDLNFSNRP-PNAGATHLAYNAQDMVFAHYGPKWKLLRKLSNLHMLGGKALENWADVRKTELGYMLKAMFESSQNNEPVMISEMLTYAMANMLSQVILSRRVFNKKGAKSNEFKDMV 216          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C84A1_ARATH (Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.312e-17
Identity = 56/180 (31.11%), Postives = 92/180 (51.11%), Query Frame = 3
Query:   93 SWILVVALNYFSRGFKSGSRR--LPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            S ++VV+L  F   F +  RR   PPGP  +P+IGN+L +    H+ LA LAK +G +  L+ G +     SS  +A+++LQ QD+ F NR    AI    +    M +      WR +RK+C    FS ++ ++   + R ++  ++  V  +C  G  I++G+  F  T N+     F
Sbjct:   18 SLVIVVSLFIFI-SFITRRRRPPYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASV-RDEVDKMVRSV--SCNVGKPINVGEQIFALTRNITYRAAF 193          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C71AM_ARATH9.819e-1826.02Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=C... [more]
C71A9_SOYBN9.819e-1832.97Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=... [more]
C71D6_SOLCH1.282e-1727.75Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71... [more]
C71AQ_ARATH1.675e-1730.13Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=C... [more]
C93A1_SOYBN2.187e-1731.75Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=... [more]
C71B2_ARATH2.187e-1727.17Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CY... [more]
C75A3_PETHY4.873e-1732.97Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
C71A6_NEPRA4.873e-1734.09Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa... [more]
C75A4_GENTR6.365e-1729.21Flavonoid 3',5'-hydroxylase OS=Gentiana triflora G... [more]
C84A1_ARATH8.312e-1731.11Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top