FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.419e-16
Identity = 57/192 (29.69%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLL--AYVQENCRAGTAIHIGQAAFGTTLNLISNTIFS---------IDLADPTSKTAREFKQQI 683
            S    LPPGPT +P+IG L  LG  PH SLA +A  +GPIM LK G   TVV S+   A+  L+  D +F NR I        ++   M +      W+ LRK+C+ H    + L+   H++  ++  +L   Y Q +      + + +       N+I   I S         +D +   S +  EF+  +
Sbjct:   33 SHHHHLPPGPTGWPIIGALPLLGTMPHVSLADMAVKYGPIMYLKLGSKGTVVASNPKAARAFLKTHDANFSNRPIDGGPTYLAYNAQDMVFAEYGPKWKLLRKLCSLHMLGPKALEDWAHVKVSEVGHMLKEMYEQSSKSVPVPVVVPEMLTYAMANMIGRIILSRRPFVITSKLDSSASASASVSEFQYMV 224          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DA_SOYBN (Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.419e-16
Identity = 55/183 (30.05%), Postives = 99/183 (54.10%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLEL-GDKP-HKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH--GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNT 620
            +LF + +   L   S    S + +LPPGP   P+IGN+ ++ G  P H  L  LA  +GP+M LK G+V+ ++ +S  MA+EI++  D +F +R  PD + +    ++  G+ +      WR LRKIC     +++++ + + +R +++ +L+  +     A TA   G + F  T ++ S T
Sbjct:   19 ILFIFFVFFKLVQRSDSKTSSTCKLPPGPRTLPLIGNIHQIVGSLPVHYYLKNLADKYGPLMHLKLGEVSNIIVTSPEMAQEIMKTHDLNFSDR--PDFVLSRIVSYNGSGIVFSQHGDYWRQLRKICTVELLTAKRVQSFRSIREEEVAELVKKI-----AATASEEGGSIFNLTQSIYSMT 194          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71B8_ARATH (Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.419e-16
Identity = 52/183 (28.42%), Postives = 95/183 (51.91%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIF 626
            L F ++  + L  F +   S   +LPPGPT  P+IGNL +LG   H S  KL+  HGP+M L+FG V  VV SS   AK++L+++D   C+R   + + ++     +  + +      WR ++K+     F+ ++    +++R ++   L+  + ++ +  T + + +A F  T  +I    F
Sbjct:    7 LCFFFLFPLLLTLFKKLLPS-KWKLPPGPTGLPIIGNLHQLGRLLHSSFHKLSLEHGPVMLLRFGVVPMVVISSKEAAKQVLKSRDLETCSRPKLVANGLFTRNFKD--IAFAQYGEDWREMKKLVGLELFNPKKHKFFRYIREEEGDLLVKKLSKSSQTQTLVDLRKAFFSFTAGIIFRVSF 186          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AP_ARATH (Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.419e-16
Identity = 45/156 (28.85%), Postives = 85/156 (54.49%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSR-RLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQEN 548
            ++  W ++     F +   SG + + PP P   P+IGNL +LG   H+SL  L++ +GP+M L  G+V  ++ SSA MA+EIL+  D +F NR          ++   +   P    WR ++ +C  H  S++ + + + +R ++I  ++A ++++
Sbjct:    5 IILLWSIIFMTILFLKKQLSGKKGKTPPSPPGLPLIGNLHQLGRHTHRSLCDLSRRYGPLMLLHLGRVPVLIVSSADMAQEILKTHDQAFANRPRSKLSQKLLYNNRDVASAPYGEYWRQMKSVCVIHLLSNKMVRSFRDVREEEITLMMAKIRKS 160          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AD_ARATH (Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=CYP71A13 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.159e-16
Identity = 50/209 (23.92%), Postives = 107/209 (51.20%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            M+M+  +   L + I ++ L  F +   +    LPP P   PVIGNL +L   PH+SL  L+  +GP+M L FG+V  +V SS   A+E+L+  D  F NR    A++   +    + + P    WR ++ +C  +  +++ +++ + +R  ++  ++  +++   + ++ ++ +       ++ S    ++       +TAR+ K+++
Sbjct:    1 MEMILSISLCLTTLITLLLLRRFLKRTAT-KVNLPPSPWRLPVIGNLHQLSLHPHRSLRSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDHKFANRPRSKAVHGLMNGGRDVVFAPYGEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEKLEKASSSSSSENLSELFITLPSDVTSRV--ALGRKHSEDETARDLKKRV 206          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C93B1_GLYEC (Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 4.125e-16
Identity = 62/207 (29.95%), Postives = 98/207 (47.34%), Query Frame = 3
Query:   78 PWLLFSWILVVALN---YFSRGFKSGSRRLPPGPT-PYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQIG 686
            P L+   +LV AL    +F   F    + LPP P    P+IG++  LG   H+S   L+  +GP+ SL FG V  VV S+   AK++LQ  + +F N  I         +E  + + P    WR ++K+  +    SR ++  QHLR ++   LL  +    RA  A++I +     T N+IS  I  +  A+      R+  +  G
Sbjct:    3 PQLVAVSVLVSALICYFFFRPYFHRYGKNLPPSPFFRLPIIGHMHMLGPLLHQSFHNLSHRYGPLFSLNFGSVLCVVASTPHFAKQLLQTNELAF-NCRIESTAVKKLTYESSLAFAPYGDYWRFIKKLSMNELLGSRSINNFQHLRAQETHQLLRLLSNRARAFEAVNITEELLKLTNNVIS--IMMVGEAEEARDVVRDVTEIFG 206          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AC_ARATH (Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.125e-16
Identity = 52/209 (24.88%), Postives = 111/209 (53.11%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            M+M+  V   L + I +  L  F +   +    LPP P   P+IGNL +L   PH+SL  L+  +GP+M L FG+V  +V SS   A+E+L+  D  F NR    A++   +    + + P    WR ++ +C  +  +++ + + + +R +++ +++  +++   + ++ ++ +  F T  + +++ I ++       +TAR+ K+++
Sbjct:    1 MEMILMVSLCLTTLITLFLLKQFLKR-TANKVNLPPSPWRLPLIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRPRSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKKLEKASSSSSSENLSE-LFVTLPSDVTSRI-ALGRKHSEDETARDLKKRV 206          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BZ_ARATH (Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 7.037e-16
Identity = 52/186 (27.96%), Postives = 98/186 (52.69%), Query Frame = 3
Query:   81 WLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENC--RAGTAIHIGQAAFGTTLNLISNTIF 626
            +L F  +L ++L  F +   S  + LPPGP   P+IGNL +LG   +KS  K+++ +GP++ L+ G V  +V SS   A+E+L+  D   C R  T    ++ +   + G  + P    WR +RKI     FS ++L + +++R ++ + L+  + ++      +++ + +  F  T ++I    F
Sbjct:    4 FLCFLLLLPLSLILFKKLLPSKGK-LPPGPIGLPIIGNLHQLGKLLYKSFHKISQEYGPVVLLRLGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIG--FAPFGDDWREMRKITTLELFSVKKLKSFRYIREEESELLVKKISKSVDETQNSSVDLRKVLFSFTASIICRLAF 186          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71A4_SOLME (Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.037e-16
Identity = 55/189 (29.10%), Postives = 101/189 (53.44%), Query Frame = 3
Query:   75 VPWLLFSWILVVALNYFS------RGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLIS 614
            VP L +S ++++ L  F          K+ +  LPP P   P+IGNL +LG  PH+SL KL++ +GP+M L  G    +V SS   A++IL+  D  +  R   +I D++  +G  + G  + P    W  +R I   H  S++++ + + +R ++  +++  +++ C A + I++G+     T N+ S
Sbjct:    3 VPCLWYSLLILLLLFIFLLIHHCFTTSKTQNMFLPPSPRKLPIIGNLHQLGSHPHRSLRKLSQKYGPVMLLHLGSKPVIVASSVDAARDILKTHDHVWATRPKYSIADSL-LYGSKDVG--FSPFGEYWWQVRSIVVLHLLSNKRVQSYRDVREEETANMIEKIRQGCDA-SVINLGEHLCFLTNNITS 187          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C80A1_BERST (Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.200e-15
Identity = 52/187 (27.81%), Postives = 92/187 (49.20%), Query Frame = 3
Query:   90 FSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKS----LAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            F  I +VAL YF   FK     LPP P  +P++G+L +L  K        ++ +A+ +GP++ LKFG  +++  S+   A E+LQ  D     R          H ++ + W    + W+  RKI ++  FS + L A +  R +   +L+ ++    + G  + +    FG  LN++ + +FS D+
Sbjct:    7 FVSISLVALLYFLL-FKPKHTNLPPSPPAWPIVGHLPDLISKNSPPFLDYMSNIAQKYGPLIHLKFGLHSSIFASTKEAAMEVLQTNDKVLSGRQPLPCFRIKPHIDYSILWSDSNSYWKKGRKILHTEIFSQKMLQAQEKNRERVAGNLVNFIM--TKVGDVVELRSWLFGCALNVLGHVVFSKDV 190          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C75A6_CAMME2.419e-1629.69Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C71DA_SOYBN2.419e-1630.05Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 P... [more]
C71B8_ARATH2.419e-1628.42Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CY... [more]
C71AP_ARATH2.419e-1628.85Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=C... [more]
C71AD_ARATH3.159e-1623.92Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=C... [more]
C93B1_GLYEC4.125e-1629.95Licodione synthase OS=Glycyrrhiza echinata GN=CYP9... [more]
C71AC_ARATH4.125e-1624.88Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=C... [more]
C71BZ_ARATH7.037e-1627.96Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=C... [more]
C71A4_SOLME7.037e-1629.10Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71... [more]
C80A1_BERST1.200e-1527.81Berbamunine synthase OS=Berberis stolonifera GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top