FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C93A3_SOYBN (Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.568e-15
Identity = 55/174 (31.61%), Postives = 83/174 (47.70%), Query Frame = 3
Query:  156 LPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTARE 668
            LPP P P P+IG+L  L   PH+   KL+  +GPI+ L  G V  VV S+A  AKE L+  + +F NR   T+      +G  +F   + P    W+ ++K+C S       LD    +R+ + +  +  V +   +G A+      FG     +SN I S  +   TS T  E
Sbjct:   31 LPPSPMPLPIIGHLHLLSPTPHQDFHKLSLRYGPIIHLFLGSVPCVVASTAEAAKEFLKTHEPAFSNRPANTVAVETLTYGFQDF--LFAPYGPYWKFMKKLCMSELLGGHMLDQFLPVRQXETKKFIKRVLQKGISGEAVD-----FGGEFITLSNNIVSRMIVSQTSTTEDE 197          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AL_ARATH (Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.047e-15
Identity = 47/184 (25.54%), Postives = 95/184 (51.63%), Query Frame = 3
Query:   63 MVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLIS 614
            M S    +L S I+ + + +F +  +      P  P   P+IGNL +LG  PH+SL  L+  +GP+M L  G+V  +V SSA +A++IL+  D  F +R          +    + + P    WR ++ +C     S++ + + +++R+++I  ++  +Q++  +   +++ +     T ++IS
Sbjct:    1 MESMTMIILQSLIIFITILFFKKQKRGKKSNTPRSPPRLPLIGNLHQLGHHPHRSLCSLSHRYGPLMLLHLGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKSVCVLRLLSNKMVTSFRNVRQEEISLMMEKIQKS--SSLQVNVSELLGSLTNDVIS 182          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DC_CATRO (Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.674e-15
Identity = 62/205 (30.24%), Postives = 95/205 (46.34%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFK-SGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFG-MPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYV--QENCRAGTAIHIGQAAFGTTLNLI-----SNTIFSIDLADPTSKTARE 668
            LLF +IL      F +  + S    LPPGP   P++GN  +L G   H  L  LAK +GP+M LK G+V+T+V SS  +A+EI +  D  F +R      +    ++F  M   P    WR LRKI      S + + + + +R +++ + +  +  +E  R   +  I    +G T          NT   I L D  +K   E
Sbjct:    1 LLFCFILSKTTKKFGQNSQYSNHDELPPGPPQIPILGNAHQLSGGHTHHILRDLAKKYGPLMHLKIGEVSTIVASSPQIAEEIFRTHDILFADRPSNLESFKIVSYDFSDMVVSPYGNYWRQLRKISMMELLSQKSVQSFRSIREEEVLNFIKSIGSKEGTRINLSKEISLLIYGITTRAAFGEKNKNTEEFIRLLDQLTKAVAE 205          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C99A3_ORYSJ (Cytochrome P450 99A3 OS=Oryza sativa subsp. japonica GN=CYP99A3 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.492e-15
Identity = 45/118 (38.14%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQL 485
            S  +R PPGP   P++G LL L   +P  +L  LA  +GP+M L+ GQV TVV SS A A+E+L+++D +F +R   +   I+ +G+ + G  + P    WR LRK+C     S++ +
Sbjct:   30 SSKKRRPPGPWNLPLVGGLLHLLRSQPQVALRDLAGKYGPVMFLRTGQVDTVVISSPAAAQEVLRDKDVTFASRPSLLVSEIFCYGNLDIG--FAPYGAYWRMLRKLCTVELLSTKMV 145          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AE_ARATH (Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.780e-15
Identity = 54/214 (25.23%), Postives = 107/214 (50.00%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSK--TAREFKQQI 683
            M+M+  +   L + + ++ L  F     +    LPP P   PVIGNL +L   PH+SL  L+  +GP+M L FG+V  +V SS+ +A ++++  D    NR    + + I+  G     M + P    WR ++ +C  +  + +++ + + +R ++I +++  V++     + +++ +      L L S+    + L    SK  +  +FK Q+
Sbjct:    1 MEMI-IISLCLATILALLLLKQFLNRTYTAKVNLPPSPWRVPVIGNLHQLSLHPHRSLRSLSHRYGPLMLLHFGRVPVLVVSSSDVAHDLMKTHDLKVANRPQLKVVEKIFNGGRE---MVFSPYGEYWRQIKSVCIVNLLNKKKVQSFEKVREEEISEMMERVEKASSDSSPLNLSE----LLLTLTSDVTSRVSLGRKYSKEESMSDFKIQM 206          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C98A2_SOYBN (Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.016e-14
Identity = 45/160 (28.12%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  153 RLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRA----GTAI----HIGQAAFGTTLNL 608
            +LPPGP P+PV+GNL ++     +  A+ A+ +GPI+S+ FG    V+ S++ +AKE+L+  D    +R    +          + W      +  +RK+C    FS ++L+A + +R  ++  ++  V  +C +    G  I    H+G  AF     L
Sbjct:   27 KLPPGPRPWPVVGNLYDIKPVRFRCFAEWAQSYGPIISVWFGSTLNVIVSNSELAKEVLKEHDQLLADRHRSRSAAKFSRDGKDLIWADYGPHYVKVRKVCTLELFSPKRLEALRPIREDEVTSMVDSVYNHCTSTENLGKGILLRKHLGVVAFNNITRL 186          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AI_ARATH (Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.016e-14
Identity = 49/186 (26.34%), Postives = 96/186 (51.61%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLIS 614
            M+M   V   L + + ++ L  F +   +    LPP P   PVIGNL +L   PH+SL  L+  +GP+M L FG+V  +V SS+  A EIL+  D  F NR    A++   +    + + P    WR ++ +C  +  +++ + + + +R +++  ++  +++   + +A ++ +     T ++ S
Sbjct:    1 MEMTLMVSLCLTTLLTLLLLKKFLKR-TAKKVNLPPSPWRIPVIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSSEAAHEILKTHDLKFANRPKSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKVREEEVNAMMEKLEKASCSSSAENLSELFVTLTSDVTS 185          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DD_MENPI (Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.327e-14
Identity = 48/164 (29.27%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  156 LPPGPTPYPVIGNL-LELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            LPPGP   P+IG+L L  G  P  +LA +AK +GP+  ++ G+V +VV SS    KE ++  D +  +R          +    + + P +  WR +RKIC S   S+R + +   +R+ ++  LL +++ +  AG A+ + +     T ++I    F   + D
Sbjct:   35 LPPGPPKLPLIGHLHLLWGKLPQHALASVAKQYGPVAHVQLGEVFSVVLSSREATKEAMKLVDPACADRFESIGTKIMWYDNDDIIFSPYSVHWRQMRKICVSELLSARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRD 198          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C99A2_ORYSJ (Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.733e-14
Identity = 55/180 (30.56%), Postives = 90/180 (50.00%), Query Frame = 3
Query:   48 RLKMDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR--TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIG 578
            R  M++ S     L S + +  L        S  +R PPGP   P++G LL L    P  +L +LA  +GP+M L+ GQ+ TVV SS A A+E+L+++D  F +R   +   I+ + + + G  + P    WR LRK+C     S++ +     +R  +   L+     N +A ++ H G
Sbjct:   23 RFIMEINSAATLTLVSLLTLPILLALLTRKSSSKKRRPPGPWNLPLVGGLLHLLRSHPQVALRELASKYGPVMFLRMGQIDTVVVSSPAAAQEVLRDKDVMFASRPSLLVSEIFCYDNLDVG--FAPYGAYWRMLRKLCTVELLSTKVVRQLAPVRNDETLTLV----RNIKAASSGHGG 196          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C93A2_SOYBN (Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.264e-14
Identity = 52/180 (28.89%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  138 KSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQ 677
            K   ++LPP P   P+IG+L  +   PH+   KL+  HGPIM L  G V  VV S+A  AKE L+  + +F NR   +       + FG    P     + ++K+C S     R LD    +R+++ +  +  V +   AG A+  G    G  + L +N I  + +   +S+  ++ ++
Sbjct:   23 KERKKKLPPSPKGLPIIGHLHLVSPIPHQDFYKLSLRHGPIMQLFLGSVPCVVASTAEAAKEFLKTHEINFSNRPGQNVAVQFLTYVFG----PYGPSVKFIKKLCMSELLGGRMLDQFLPVRQQETKKFIKRVLQKGIAGEAVDFG----GEFMRLSNNIISRMTMNQTSSEDEKQAEE 194          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C93A3_SOYBN1.568e-1531.61Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=... [more]
C71AL_ARATH2.047e-1525.54Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=C... [more]
C71DC_CATRO2.674e-1530.24Tabersonine 16-hydroxylase (Fragment) OS=Catharant... [more]
C99A3_ORYSJ3.492e-1538.14Cytochrome P450 99A3 OS=Oryza sativa subsp. japoni... [more]
C71AE_ARATH7.780e-1525.23Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=C... [more]
C98A2_SOYBN1.016e-1428.13Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=... [more]
C71AI_ARATH1.016e-1426.34Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=C... [more]
C71DD_MENPI1.327e-1429.27Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D... [more]
C99A2_ORYSJ1.733e-1430.56Cytochrome P450 99A2 OS=Oryza sativa subsp. japoni... [more]
C93A2_SOYBN2.264e-1428.89Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top