FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C98A3_ARATH (Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.282e-13
Identity = 36/133 (27.07%), Postives = 71/133 (53.38%), Query Frame = 3
Query:  153 RLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENC 551
            + PPGP+P P++GNL ++     +   + A+ +GPI+S+  G +  VV SSA +AKE+L+  D    +R    +  A   +   + W      +  +RK+C    F+ ++L++ + +R  ++  ++  V  +C
Sbjct:   26 KFPPGPSPKPIVGNLYDIKPVRFRCYYEWAQSYGPIISVWIGSILNVVVSSAELAKEVLKEHDQKLADRHRNRSTEAFSRNGQDLIWADYGPHYVKVRKVCTLELFTPKRLESLRPIREDEVTAMVESVFRDC 158          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C7D95_MENSP (Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.282e-13
Identity = 50/171 (29.24%), Postives = 88/171 (51.46%), Query Frame = 3
Query:  138 KSGSRR-LPPGPTPYPVIGNL-LELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLAD 644
            KS SR+ LPPGP   P++G+L L  G  P  ++A +AK +GP+  ++ G+V +VV SS    KE ++  D +  +R          +    + + P +  WR +RKIC S   S+R + +   +R+ ++  LL ++Q +  AG  + + +     T ++I    F   + D
Sbjct:   27 KSESRQNLPPGPPKLPLVGHLHLLWGKLPQHAMADMAKKYGPVTHVQLGEVFSVVLSSREATKEAMKLLDPACADRFESIGTRIMWYDNDDIIFSPYSDHWRQMRKICVSELLSARNVRSFGFIRQDEMSRLLRHLQSS--AGETVDMTERIATLTCSIICRAAFGAIIND 195          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AJ_ARATH (Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.511e-13
Identity = 45/157 (28.66%), Postives = 81/157 (51.59%), Query Frame = 3
Query:  156 LPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQ--ENCRAGTAIHIGQAAFGTTLNLI 611
            LPP P   PVIGNL +L    H+SL  L+  +GP+M L FG+   ++ SSA +A +IL+  D    NR    + D I   G     + + P    W+ ++ IC  +  S++ + + + +R  +I+ ++  V+   +C   + +++ Q     T ++I
Sbjct:   33 LPPSPWRLPVIGNLHQLSLNTHRSLRSLSLRYGPLMLLHFGRTPVLIVSSADVAHDILKTYDVICANRPKTKVIDKILRGGR---DVAFAPYGEYWKQMKSICIQNLLSNKMVRSYKKIREDEIKLMIEKVENASSCSPPSPVNLSQLFMTLTNDII 186          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.242e-12
Identity = 56/167 (33.53%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  102 LVVALNYFSRG--FKSGSRRLPPGPTPYPVIGNL-LELGDK-PHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH--GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQA 584
            L++ L  F RG  +KSG    P     +P+IG+L L LG K PHK+L  LA  +GPI S+K G    VV S+  MAKE     D +    ++PD I A+   ++   +   P    WR LRKI  S   S  +++   H+R  ++Q  +  +  + R+   +  G A
Sbjct:   17 LILLLYLFLRGGSWKSGEEGPPTVAGAWPIIGHLPLLLGSKTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAV--SSLPDLISANLLCYNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRVSEVQSSITELFRDWRSNKNVQSGFA 181          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C81F1_ARATH (Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.622e-12
Identity = 53/166 (31.93%), Postives = 82/166 (49.40%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQ-DTSFCNRTIP-DAIY-AHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLA----YVQENCRAGTAIHI 575
            +L + ++Y     K+    LPPGP   P +G+L  +    H+ L + +  +GPI SL+FG    VV +S ++A+E    Q D    +R +   A Y A+ H   G    P    WRNLR+IC+    SS +L   QH+R+ +I  +L     Y Q +  +    HI
Sbjct:    9 LLFLVISYKFLYSKTQRFNLPPGPPSRPFVGHLHLMKPPIHRLLQRYSNQYGPIFSLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGT--APYGDHWRNLRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHI 172          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DI_MENSP (Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.622e-12
Identity = 49/195 (25.13%), Postives = 100/195 (51.28%), Query Frame = 3
Query:   51 LKMDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAY----------VQENCRAGTAIHIGQAAFGTTL 602
            +++D++S +  L+ ++I+ + +N + +      + LPP P   PVIG+L  L G  P      +A+ +GP+  ++ G+V +VV SSA  AK+ ++  D +F +R          + +  + + P    WR +R+IC +   S + + +  ++R+++I+ L+            V E     + + + +AAFG+ L
Sbjct:    1 MELDLLSAIIILVATYIVSLLINQWRKS--KSQQNLPPSPPKLPVIGHLHFLWGGLPQHVFRSIAQKYGPVAHVQLGEVYSVVLSSAEAAKQAMKVLDPNFADRFDGIGSRTMWYDKDDIIFSPYNDHWRQMRRICVTELLSPKNVRSFGYIRQEEIERLIRLLGSSGGAPVDVTEEVSKMSCVVVCRAAFGSVL 193          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71DI_MENGR (Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.622e-12
Identity = 49/195 (25.13%), Postives = 100/195 (51.28%), Query Frame = 3
Query:   51 LKMDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLEL-GDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAY----------VQENCRAGTAIHIGQAAFGTTL 602
            +++D++S +  L+ ++I+ + +N + +      + LPP P   PVIG+L  L G  P      +A+ +GP+  ++ G+V +VV SSA  AK+ ++  D +F +R          + +  + + P    WR +R+IC +   S + + +  ++R+++I+ L+            V E     + + + +AAFG+ L
Sbjct:    1 MELDLLSAIIILVATYIVSLLINQWRKS--KSQQNLPPSPPKLPVIGHLHFLWGGLPQHVFRSIAQKYGPVAHVQLGEVYSVVLSSAEAAKQAMKVLDPNFADRFDGIGSRTMWYDKDDIIFSPYNDHWRQMRRICVTELLSPKNVRSFGYIRQEEIERLIRLLGSSGGAPVDVTEEVSKMSCVVVCRAAFGSVL 193          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71AK_ARATH (Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.622e-12
Identity = 45/181 (24.86%), Postives = 94/181 (51.93%), Query Frame = 3
Query:   84 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNR---TIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQE-NCRAG-TAIHIGQAAFGTTLNLI 611
            L  + +L + L    +   + +  LPP P   PVIGNL +L    H+SL  L+  +GP+M L FG+   ++ SSA +A ++++  D    NR    + D I + G     + + P    WR ++ IC  +  +++ + + + +R ++I+ ++  +++ +C +  + +++ Q     T ++I
Sbjct:    8 LCLTTLLALLLKSILKRTATKNFNLPPSPWRLPVIGNLHQLSLHTHRSLRSLSLRYGPLMLLHFGRTPVLIVSSADVAHDVMKTHDLVCANRPKTKVVDKILSGGR---DVAFAPYGEYWRQMKSICIQNLLNNKMVRSYEKIREEEIKRMIEKLEKASCSSSPSPVNLSQILMTLTNDII 185          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.119e-12
Identity = 52/173 (30.06%), Postives = 87/173 (50.29%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDK-PHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRT---IPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGT 563
            MD++     LL S++ ++     S+  +    +LPPGP P PV GN L++GD   H++L  LAK  G I+ L+ GQ   VV SS  ++KE+L  Q   F +RT   + D     G     M +      WR +R+I     F+++ +   ++   ++   ++  V++N  A T
Sbjct:    1 MDLLLLEKTLLGSFVAILVAILVSK-LRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRMGQRNLVVVSSPELSKEVLHTQGVEFGSRTRNVVFDIFTGKGQ---DMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEEEAAQVVEDVKKNPGAAT 169          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.119e-12
Identity = 53/173 (30.64%), Postives = 86/173 (49.71%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDK-PHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRT---IPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGT 563
            MD++     LL S++ V+     S+  +    +LPPGP P PV GN L++GD   H++L  LAK  G I  L+ GQ   VV SS  ++KE+L  Q   F +RT   + D     G     M +      WR +R+I     F+++ +   ++   ++   ++  V++N  A T
Sbjct:    1 MDLLLLEKTLLGSFVAVLVAILVSK-LRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQ---DMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEEEAAQVVEDVKKNPEAAT 169          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C98A3_ARATH7.282e-1327.07Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CY... [more]
C7D95_MENSP7.282e-1329.24Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D9... [more]
C71AJ_ARATH9.511e-1328.66Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=C... [more]
C82A2_SOYBN1.242e-1233.53Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=... [more]
C81F1_ARATH1.622e-1231.93Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CY... [more]
C71DI_MENSP1.622e-1225.13Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D1... [more]
C71DI_MENGR1.622e-1225.13Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D... [more]
C71AK_ARATH1.622e-1224.86Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=C... [more]
TCMO_POPTM2.119e-1230.06Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_POPKI2.119e-1230.64Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top