FC931322

Overview
NameFC931322
Unique NameFC931322
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig309 contig Ccv1_Contig309:20..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METMP (30S ribosomal protein S13P OS=Methanococcus maripaludis GN=rps13p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.170e-17
Identity = 42/127 (33.07%), Postives = 76/127 (59.84%), Query Frame = 1
Query:  106 DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +F+H +R+  T+++GK  + +AL  +KGIGR +A  V +  ++D  ++AG L+  ++  +  V+ +P    IP W  NR+KD   G    ++   L + +++D+  +KKIR ++G+RH   L  RGQ
Sbjct:    5 EFKHRIRISKTDLEGKNPLEYALQDMKGIGRAMARAVIRVTELDPKQQAGYLADEDVLKIESVLEDPATHGIPSWMFNRKKDVYSGLDKHLIETDLVLTVQEDITNMKKIRCYKGIRHELRLPCRGQ 131          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METMJ (30S ribosomal protein S13P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps13p PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.170e-17
Identity = 46/128 (35.94%), Postives = 75/128 (58.59%), Query Frame = 1
Query:  103 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            E+ ++ +RV NT++DG + +  ALT IKGIG   +  +   A VD +   G+L    +  +   V    + ++PDW +NRQKD   G+   ++   L M   DD+ R++K+R++RG+RH  G +VRGQ
Sbjct:    4 EEIKYFVRVRNTDLDGTKAVHIALTGIKGIGPHTSRTITALAAVDPHAILGKLDDESVGRIANAVDTYTE-QVPDWMVNRQKDVYTGEVRHLLGTDLTMMNDDDVNRMRKMRSYRGIRHETGQKVRGQ 130          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_METLZ (30S ribosomal protein S13P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps13p PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.077e-16
Identity = 50/150 (33.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:   94 VANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVV-ANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 540
            V   + ++ +R++NT++DG Q +  ALT IKGIG   A I+ ++A VD     G L   ++  +   V A P    +P W +NR  D   G+   +  + L +   DD+  +KK+R +RG+RH  GL+VRGQ              SK+R
Sbjct:    2 VEESELKYFVRIINTDLDGTQPVQLALTGIKGIGLHAALIIARRAGVDTRATMGLLGDEDVAAIEEQVKAYPAS--VPKWMVNRPVDVYSGEPKHLYGSDLSLAKEDDINLMKKMRCYRGIRHENGLKVRGQRTKATGRFGKIVGVSKRR 149          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PYRCJ (30S ribosomal protein S13P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps13p PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.407e-16
Identity = 42/128 (32.81%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  103 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            ++ + I+R+ +T++DG + + +AL  I+GIG   A  +C+K  +D +   G L   +++ L   V N  +   P WFLNR+KD + G+   ++ + L +  + D++ +KK+++ +G+RH  GL+VRGQ
Sbjct:    3 QEIRAIVRIGDTDLDGNKTVAYALAKIRGIGIATAYAICRKLGIDPHATLGLLPEDQINKLDWAVRNLHELA-PAWFLNRRKDPETGRDLHLIGSELVLAAKRDVDLMKKLKSWKGIRHSLGLKVRGQ 129          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_HALWD (30S ribosomal protein S13P OS=Haloquadratum walsbyi (strain DSM 16790) GN=rps13p PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.837e-16
Identity = 46/129 (35.66%), Postives = 74/129 (57.36%), Query Frame = 1
Query:  100 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            ++D Q+ +R+  T++DG + +  +LT +KGIG+R A I+   A VD +   G L   E+D++   V N     IP W  NR++D+  G         L+ K R D+ R+K I +++G+RH  G +VRGQ
Sbjct:   15 DDDLQYFVRIGTTDLDGTKAVERSLTDMKGIGKRTARIITDVASVDRHATFGLLEEDEIDSITDAVEN-LDDHIPGWMTNRREDFFSGDTDHKTGADLEEKRRHDVNRMKMIDSYKGVRHKRGQKVRGQ 142          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_CENSY (30S ribosomal protein S13P OS=Cenarchaeum symbiosum GN=rps13p PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.837e-16
Identity = 39/128 (30.47%), Postives = 77/128 (60.16%), Query Frame = 1
Query:  103 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            ++++HI+R+L  ++ G++K +  L  I+GIG   A  +     +D N   G L+  ++ ++  ++ +P     P WFLNR+KD + G+   + ++ ++  +R+D+ER +   + +G RH +GL+VRGQ
Sbjct:   49 QEYKHIVRILGNDLPGEKKAVVGLRQIRGIGYGFATAILDVLKIDNNSNIGYLTDEQVASIEKLLQDPAGAGFPTWFLNRRKDLETGEDRHIFTSDIEFTVRNDVERERVSGSWKGYRHMFGLKVRGQ 176          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PYRAE (30S ribosomal protein S13P OS=Pyrobaculum aerophilum GN=rps13p PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.093e-16
Identity = 42/129 (32.56%), Postives = 80/129 (62.02%), Query Frame = 1
Query:  100 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +++ + I+R+ +T++DG +++ +AL  I+GIG   A  +C K  +D +   G L   +++ L   V N  +   P WFLNR+KD + G+   ++ + L +  + D++ +KK+++ +G+RH  GL+VRGQ
Sbjct:    2 SQEIRAIVRIGDTDLDGNKQVAYALAKIRGIGIASAYAICWKLGIDPHAILGALPEDQINKLDWAVRNLHELA-PAWFLNRRKDPETGRDLHLIGSELVLAAKRDVDLMKKLKSWKGVRHSLGLKVRGQ 129          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_PYRAR (30S ribosomal protein S13P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps13p PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.346e-16
Identity = 42/129 (32.56%), Postives = 80/129 (62.02%), Query Frame = 1
Query:  100 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +++ + I+RV +T+++G +++ +AL  I+GIG   A  +C K  +D +   G L   +++ L   V N  +   P WFLNR+KD + G+   ++ + L +  + D++ +KK+++ +G+RH  GL+VRGQ
Sbjct:    2 SQELRAIVRVGDTDLEGNKQVAYALAKIRGIGIASAYAICWKLGIDPHAVLGALPEEQINKLDWAVRNLHEVA-PAWFLNRRKDPETGRDMHLIGSELVLAAKRDVDLMKKLKSWKGIRHSLGLKVRGQ 129          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_HALSA (30S ribosomal protein S13P OS=Halobacterium salinarium GN=rps13p PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.465e-15
Identity = 41/129 (31.78%), Postives = 73/129 (56.59%), Query Frame = 1
Query:  100 NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            +ED Q+ +R+  T++DG + +  AL  + G+GRR+A IV  +A VD     G L    ++++   V +  +   P W  NRQ D+  G+   +    +++    D+ R++ IR+++G+RH  G +VRGQ
Sbjct:   10 DEDIQYFVRIGQTDLDGTKTVERALAELGGVGRRVARIVADEAGVDRTATMGGLEDDAIESVTDAVDSFTEHA-PAWLANRQNDFYTGENQHITGTDVELTRDQDINRMRMIRSYKGIRHERGQKVRGQ 137          
BLAST of FC931322 vs. ExPASy Swiss-Prot
Match: RS13_NANEQ (30S ribosomal protein S13P OS=Nanoarchaeum equitans GN=rps13p PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.246e-14
Identity = 41/123 (33.33%), Postives = 67/123 (54.47%), Query Frame = 1
Query:  118 ILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQ 486
            I+ + + ++DG + I   L  + G+    A+ VC    +D  ++ G LS  EL+ L   + NP ++ IP W  NR++D + GK   +V N   + +  D++R  +I + RG RH  GL VRGQ
Sbjct:   13 IVHIADVDLDGHKPIYVELRKVVGVNWMFAHAVCAALGIDKWRKIGSLSDEELEKLEDALRNPWKYGIPSWLYNRRRDPETGKDLHLVGNDYKITMEFDIKREMQINSWRGYRHREGLPVRGQ 135          
The following BLAST results are available for this feature:
BLAST of FC931322 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS13_METMP2.170e-1733.0730S ribosomal protein S13P OS=Methanococcus maripa... [more]
RS13_METMJ2.170e-1735.9430S ribosomal protein S13P OS=Methanoculleus maris... [more]
RS13_METLZ1.077e-1633.3330S ribosomal protein S13P OS=Methanocorpusculum l... [more]
RS13_PYRCJ1.407e-1632.8130S ribosomal protein S13P OS=Pyrobaculum calidifo... [more]
RS13_HALWD1.837e-1635.6630S ribosomal protein S13P OS=Haloquadratum walsby... [more]
RS13_CENSY1.837e-1630.4730S ribosomal protein S13P OS=Cenarchaeum symbiosu... [more]
RS13_PYRAE4.093e-1632.5630S ribosomal protein S13P OS=Pyrobaculum aerophil... [more]
RS13_PYRAR5.346e-1632.5630S ribosomal protein S13P OS=Pyrobaculum arsenati... [more]
RS13_HALSA3.465e-1531.7830S ribosomal protein S13P OS=Halobacterium salina... [more]
RS13_NANEQ2.246e-1433.3330S ribosomal protein S13P OS=Nanoarchaeum equitan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103H05EF PostHarvP1 Citrus clementina cDNA clone C34103H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931322 ID=FC931322|Name=FC931322|organism=Citrus clementina|type=EST|length=721bp
GGCAGTTGGCTTGGCTACTTGCTGCAGCTTCATCTGTCGCCGAAGAGCCT
CTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGGCGA
ACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGACGGG
AAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAGGCG
ACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGAGGG
CCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTTGCA
AATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAAGGA
TTACAAGGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACATGA
AGTTGAGAGATGACTTGGAGCGTCTGAAGAAGATCAGGAACCACCGTGGT
CTCAGGCACTACTGGGGTCTTCGTGTCCGTGGACAACACACCAAGACCAC
CGGCCGTCGTGGAAAGACTGTTGGTGTCTCCAAGAAGCGTTGAGCTGTCC
TTTATCAATGTTTTGAACAATCTATACACATGTTCAGGAAGAGTTTGGAC
TTGCTATTGCTGAACATTTGCATCAGACAATATTAGATTTATTTTCTTTT
CTTTGGATGGGTTTTAAGCATTTGAACTGGCTGNCTTTTATCTATTATTT
TCTCTATGGGAATATTTTTAT
back to top