FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS8_ORYSJ (MADS-box transcription factor 8 OS=Oryza sativa subsp. japonica GN=MADS8 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 8.900e-72
Identity = 150/231 (64.94%), Postives = 174/231 (75.32%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSARE-ALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGY------GLKPAQPQ-GDTFFHALE--CEPTLXIGYQP 670
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS  SM +TLERYQK +YG P+  +  +E  L  SS+ EYLKLKAR E LQR+QRNLLGE+LG L  KELE LE+QLD SL+ IRSTRTQ+MLD LT+LQ +EQ+L EANK L+++L E  Q++       A   GY       ++   P  G+ FFH+LE   EPTL IG+ P
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGQSMTRTLERYQKFSYGGPDTAIQNKENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEESNQLHGQVWEHGATLLGYERQSPHAVQQVPPHGGNGFFHSLEAAAEPTLQIGFTP 231          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: CMB1_DIACA (MADS-box protein CMB1 OS=Dianthus caryophyllus GN=CMB1 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.278e-66
Identity = 141/238 (59.24%), Postives = 172/238 (72.27%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFH--ALECEPTLXIGYQPA--DPISVVTAGPSL 709
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+S M KTLERYQ+C+YG+ E +  ++E    SS QEYLKLKA+ + LQRS RNLLGE+LG L++KELE LE QLD SL+QIRS +TQ+MLD L +LQ KE++L E+N+ LK +L E    +     P+ +         +  GD FF    L C   L IGY  A  D ++  T+  ++
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSCMNKTLERYQRCSYGSLETSQPSKET--ESSYQEYLKLKAKVDVLQRSHRNLLGEDLGELSTKELEQLEHQLDKSLRQIRSIKTQHMLDQLADLQKKEEMLFESNRALKTKLEE----SCASFRPNWD--------VRQPGDGFFEPLPLPCNNNLQIGYNEATQDQMNATTSAQNV 224          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS5_ORYSJ (MADS-box transcription factor 5 OS=Oryza sativa subsp. japonica GN=MADS5 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.596e-63
Identity = 131/220 (59.55%), Postives = 161/220 (73.18%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQ 667
            MGRG+VELKRIENKI+RQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RG+L+EF +SS M KTLERY+ CNY       SA    ELS+ QEYLKLK R E LQ +QRNLLGE+L PL+ KELE LE Q+++SL  IRS++ Q +LD + EL+ KEQ L +ANK LK+++ E    N L +  S +D G     ++   +   HA+ C+P+L IGYQ
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTLERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHI--SCQDVGPSGHASEANQEFLHHAI-CDPSLHIGYQ 217          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS5_ORYSI (MADS-box transcription factor 5 OS=Oryza sativa subsp. indica GN=MADS5 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.596e-63
Identity = 131/220 (59.55%), Postives = 161/220 (73.18%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQ 667
            MGRG+VELKRIENKI+RQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RG+L+EF +SS M KTLERY+ CNY       SA    ELS+ QEYLKLK R E LQ +QRNLLGE+L PL+ KELE LE Q+++SL  IRS++ Q +LD + EL+ KEQ L +ANK LK+++ E    N L +  S +D G     ++   +   HA+ C+P+L IGYQ
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTLERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHI--SCQDVGPSGHASEANQEFLHHAI-CDPSLHIGYQ 217          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS1_ORYSJ (MADS-box transcription factor 1 OS=Oryza sativa subsp. japonica GN=MADS1 PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.315e-58
Identity = 125/225 (55.56%), Postives = 155/225 (68.89%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLN------PSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGY 664
            MGRG+VELKRIENKI+RQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RG+L+EF SSS M KTLERY+ CNY + +      E     + QEYLKLK R E LQ +QRN+LGE+LGPL+ KELE LE Q+++SLKQIRS + Q +LD L +L+ KEQ L + NK L+++L E    N L ++       S        +P   QG    H  + + +L IGY
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEI----NYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHSLQIGY 221          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS1_ORYSI (MADS-box transcription factor 1 OS=Oryza sativa subsp. indica GN=MADS1 PE=2 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 7.315e-58
Identity = 125/225 (55.56%), Postives = 155/225 (68.89%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLN------PSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGY 664
            MGRG+VELKRIENKI+RQVTFAKRRNGLLKKAYELS+LCDAEVALIIFS RG+L+EF SSS M KTLERY+ CNY + +      E     + QEYLKLK R E LQ +QRN+LGE+LGPL+ KELE LE Q+++SLKQIRS + Q +LD L +L+ KEQ L + NK L+++L E    N L ++       S        +P   QG    H  + + +L IGY
Sbjct:    1 MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEI----NYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHSLQIGY 221          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL3_ARATH (Agamous-like MADS-box protein AGL3 OS=Arabidopsis thaliana GN=AGL3 PE=1 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 1.056e-56
Identity = 113/174 (64.94%), Postives = 144/174 (82.76%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS-SSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAE+AL+IFSNRGKLYEFCSS S M +T+++Y+K +Y   +PN SA++  +    Q+YLKLK+R E LQ SQR+LLGEEL  ++  ELE LERQ+D SL+QIRST+ + MLD L++L+ KE++L E N+ L+++L
Sbjct:    1 MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCSSPSGMARTVDKYRKHSYATMDPNQSAKDLQD--KYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKL 172          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS6_ORYSJ (MADS-box transcription factor 6 OS=Oryza sativa subsp. japonica GN=MADS6 PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 5.242e-56
Identity = 127/222 (57.21%), Postives = 156/222 (70.27%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL-MEGYQVN--TLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGY 664
            MGRGRVELKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLYEF  S+ + KTLERYQ C Y A + N +  E    S   E  KLKA++EALQR+QR+LLGE+LGPL+ KEL+ LE+QL+ +L Q R  +TQ M++ + EL+ KE+ L E N+ LK +L +EG   N   +Q    A+        A  Q      A++ EPTL IGY
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEF-GSAGITKTLERYQHCCYNAQDSNNALSET--QSWYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKHKLEVEGSTSNYRAMQQASWAQGAVVENGAAYVQPPPHSAAMDSEPTLQIGY 219          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD17_ORYSJ (MADS-box transcription factor 17 OS=Oryza sativa subsp. japonica GN=MADS17 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 1.686e-54
Identity = 122/227 (53.74%), Postives = 153/227 (67.40%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED--------CGYGLKPAQPQGDTFFHALECEPTLXIGY 664
            MGRGRVELKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFS+RGKLYEF  S+ + KTLE+Y  C Y A   N +       S  QE  +LK + E LQRSQR++LGE+LGPL+ KEL+ LE+QL+ SL Q R  +TQ M++ + +L+ KE+ L E NK LK +L    + ++     + +D         G  +  AQP  D     ++CEPTL IGY
Sbjct:    1 MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEF-GSAGINKTLEKYNSCCYNAQGSNSALAGGEHQSWYQEMSRLKTKLECLQRSQRHMLGEDLGPLSIKELQQLEKQLEYSLSQARQRKTQIMMEQVDDLRRKERQLGELNKQLKNKLEA--EADSSNCRSAIQDSWVHGTVVSGGRVLNAQPPPD-----IDCEPTLQIGY 219          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD34_ORYSJ (MADS-box transcription factor 34 OS=Oryza sativa subsp. japonica GN=MADS34 PE=2 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 4.906e-54
Identity = 119/231 (51.52%), Postives = 156/231 (67.53%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYG-------LKPAQPQGDTFFHALECEPTLXIGYQPADP 679
            MGRG+V L+RIENKI+RQVTFAKRRNGLLKKAYELS+LCDAEVAL++FS+ G+LY+F SSS+MLKTLERYQ+  Y + +      + ++ ++ QEY+ LKA  E LQ+SQRNLLGE+L PL + ELE LE Q+  +LKQIRS +TQ +LD L +L+ KEQ+L +AN+ LK++L E          P   +C  G            PQ + FF AL     + +   PA P
Sbjct:    1 MGRGKVVLQRIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSSSSNMLKTLERYQRYIYASQDAAAPTSDEMQ-NNYQEYVNLKAHVEILQQSQRNLLGEDLAPLATNELEQLESQVVRTLKQIRSRKTQVLLDELCDLKRKEQMLQDANRVLKRKLDEIDVEAAPPQPPWNGNCSNGHGGGGGVFSSEPPQPEHFFQALGLH-AVDVNQPPAPP 229          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MADS8_ORYSJ8.900e-7264.94MADS-box transcription factor 8 OS=Oryza sativa su... [more]
CMB1_DIACA4.278e-6659.24MADS-box protein CMB1 OS=Dianthus caryophyllus GN=... [more]
MADS5_ORYSJ2.596e-6359.55MADS-box transcription factor 5 OS=Oryza sativa su... [more]
MADS5_ORYSI2.596e-6359.55MADS-box transcription factor 5 OS=Oryza sativa su... [more]
MADS1_ORYSJ7.315e-5855.56MADS-box transcription factor 1 OS=Oryza sativa su... [more]
MADS1_ORYSI7.315e-5855.56MADS-box transcription factor 1 OS=Oryza sativa su... [more]
AGL3_ARATH1.056e-5664.94Agamous-like MADS-box protein AGL3 OS=Arabidopsis ... [more]
MADS6_ORYSJ5.242e-5657.21MADS-box transcription factor 6 OS=Oryza sativa su... [more]
MAD17_ORYSJ1.686e-5453.74MADS-box transcription factor 17 OS=Oryza sativa s... [more]
MAD34_ORYSJ4.906e-5451.52MADS-box transcription factor 34 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top