FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL8_SOLLC (Agamous-like MADS-box protein AGL8 homolog OS=Solanum lycopersicum GN=TDR4 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.524e-44
Identity = 93/175 (53.14%), Postives = 130/175 (74.29%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRGRV+LKRIENKINRQVTF+KRR+GLLKKA+E+SVLCDAEV LI+FS +GKL+E+ + S M + LERY++ ++ A +  V       +S   E+ KLKAR E LQR+Q++ +GE+L  L+ KEL++LE QLD +LK IRS + Q M ++++ LQ K++ L E N  L +++ E
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSCMERILERYERYSF-AEKQLVPTDHTSPVSWTLEHRKLKARLEVLQRNQKHYVGEDLESLSMKELQNLEHQLDSALKHIRSRKNQLMHESISVLQKKDRALQEQNNQLSKKVKE 174          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL8_ARATH (Agamous-like MADS-box protein AGL8 OS=Arabidopsis thaliana GN=AGL8 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 7.851e-44
Identity = 94/178 (52.81%), Postives = 132/178 (74.16%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPE---PNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRGRV+LKRIENKINRQVTF+KRR+GLLKKA+E+SVLCDAEVALI+FS++GKL+E+ + S M + LERY +  Y   +    +VS  E   L    E+ KLKAR E L++++RN +GE+L  L+ KEL+SLE QLD ++K IRS + Q M ++++ LQ K++ L + N +L +++ E
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYSTDSCMERILERYDRYLYSDKQLVGRDVSQSENWVL----EHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKE 174          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL8_SOLTU (Agamous-like MADS-box protein AGL8 homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.025e-43
Identity = 93/175 (53.14%), Postives = 128/175 (73.14%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRGRV+LKRIENKINRQVTF+KRR+GLLKKA+E+SVLCDAEV LI+FS +GKL+E+ + S M + LERY++ ++ A    V        S   E+ KLKAR E LQR+Q++ +GE+L  LN KEL++LE QLD +LK IRS + Q M ++++ LQ +++ L E N  L +++ E
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYANDSCMERLLERYERYSF-AERQLVPTDHTSPGSWTLEHAKLKARLEVLQRNQKHYVGEDLESLNMKELQNLEHQLDSALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKVKE 174          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL13_ARATH (Agamous-like MADS-box protein AGL13 OS=Arabidopsis thaliana GN=AGL13 PE=2 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 5.627e-42
Identity = 99/192 (51.56%), Postives = 135/192 (70.31%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS--QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL----MEGYQVNTLQLNP 565
            MGRG+VE+KRIENKI RQVTF+KR++GLLKKAYELSVLCDAEV+LIIFS  GKLYEF S+  + +T+ERY +C     + N+   + LE +   +QE  KLK +YE+L R+ RNL+GE+L  ++ KEL++LERQL+ +L   R  +TQ M++ + EL+ KE+ L + N  LK        +G+Q   L LNP
Sbjct:    1 MGRGKVEVKRIENKITRQVTFSKRKSGLLKKAYELSVLCDAEVSLIIFSTGGKLYEF-SNVGVGRTIERYYRC-----KDNLLDNDTLEDTQGLRQEVTKLKCKYESLLRTHRNLVGEDLEGMSIKELQTLERQLEGALSATRKQKTQVMMEQMEELRRKERELGDINNKLKLETEDHDFKGFQ--DLLLNP 184          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL8_SOLCO (Agamous-like MADS-box protein AGL8 homolog OS=Solanum commersonii GN=SCM1 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.253e-41
Identity = 91/175 (52.00%), Postives = 126/175 (72.00%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRGRV+LKRIENKINRQVTF+KRR+GLLKKA+E+SVLCDAEV LI+FS +GKL+E+ + S M + LERY++ ++ A +  V        S   E  KLKAR E LQR+++  +GE+L  LN KEL++LE QL  +LK IRS + Q M ++++ LQ +++ L E N  L +++ E
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYATDSCMERLLERYERYSF-AEKQLVPTDHTSPGSWTLENAKLKARLEVLQRNEKLYVGEDLESLNMKELQNLEHQLASALKHIRSRKNQLMHESISVLQKQDRALQEQNNQLSKKVKE 174          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD21_ORYSJ (MADS-box transcription factor 21 OS=Oryza sativa subsp. japonica GN=MADS21 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.647e-41
Identity = 97/237 (40.93%), Postives = 146/237 (61.60%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNY----GAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIG---YQPADPISVVTA 697
            MGRG++E+KRIENK +RQVTF KRRNGLLKKAYEL++LCDAE+ALI+FS+RG+LYEF + +S   T+ERY+K +      AP  +V++ +      QQE  K++ + + LQ + R+L+GE +G + +KEL+SLE +L+  + +IRS + + +   +  +Q +E  L   N  L+ ++ E  +        +AED      PA   G +    LE  P        YQPA P+S++ A
Sbjct:    1 MGRGKIEIKRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIVFSSRGRLYEFSNVNSTRSTIERYKKASASTSGSAPVIDVNSHQYF----QQEAAKMRHQIQTLQNANRHLIGESIGNMTAKELKSLENRLEKGISRIRSKKHELLFSEIEYMQKREADLQNENMFLRAKVAEAERAEH-DDQQAAEDDEMAPAPAVGGGSSSGTELEALPATFDTREYYQPAPPVSMLAA 232          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL1_ARATH (Agamous-like MADS-box protein AGL1 OS=Arabidopsis thaliana GN=AGL1 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.266e-40
Identity = 89/189 (47.09%), Postives = 129/189 (68.25%), Query Frame = 2
Query:    2 EEMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPS 568
            +++GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVAL+IFS RG+LYE+ +++S+  T+ERY+K    A  P  S  EA     QQE  KL+ +   +Q S R+++GE LG LN KEL++LE +L+  + ++RS + + ++  +  +Q +E  L   N  L+ ++ EG ++N  Q   S
Sbjct:   14 KKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEY-ANNSVRGTIERYKKACSDAVNP-PSVTEANTQYYQQEASKLRRQIRDIQNSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKNELLVAEIEYMQKREMELQHNNMYLRAKIAEGARLNPDQQESS 200          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AG_PANGI (Floral homeotic protein AGAMOUS OS=Panax ginseng GN=AG2 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.458e-39
Identity = 90/201 (44.78%), Postives = 132/201 (65.67%), Query Frame = 2
Query:    5 EMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNT-LQLNPSAEDCGYGLKPAQ 604
            ++GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS RG+LYE+ +++S+  T+ERY+K    +P  + S  EA     QQE  KL+    ++Q++ RN++GE LG L  ++L+ LE +L+  + +IRS + + +   +  +Q KE  L   N+ L+ ++ E  +    + L P + D  Y L P Q
Sbjct:   16 KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEY-ANNSVKGTIERYKKACTDSPNTS-SVSEANAQFYQQEASKLRQEISSIQKNNRNMMGESLGSLTVRDLKGLETKLEKGISRIRSKKNELLFAEIEYMQKKEIDLHNNNQYLRAKIAENERAQQHMNLMPGSSD--YELAPPQ 212          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AG_BRANA (Floral homeotic protein AGAMOUS OS=Brassica napus GN=AG1 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.605e-39
Identity = 92/208 (44.23%), Postives = 135/208 (64.90%), Query Frame = 2
Query:   11 GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS---QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN-TLQLNPSAEDCGYGLKPAQPQGDTF 622
            GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS+RG+LYE+ S++S+  T+ERY+K    A   N +     E+++   QQE  KL+ +  ++Q S R L+GE +G ++ KEL +LE +LD S+ +IRS + + +   +  +Q +E  L   N+ L+ ++ E  + N ++ L P   +    + P Q Q   F
Sbjct:   18 GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY-SNNSVKGTIERYKK----AISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSKKNELLFAEIDYMQKREVDLHNDNQLLRAKIAENERNNPSMSLMPGGSNYEQIMPPPQTQPQPF 220          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AG_ARATH (Floral homeotic protein AGAMOUS OS=Arabidopsis thaliana GN=AG PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 7.605e-39
Identity = 91/208 (43.75%), Postives = 135/208 (64.90%), Query Frame = 2
Query:   11 GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS---QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN-TLQLNPSAEDCGYGLKPAQPQGDTF 622
            GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS+RG+LYE+ S++S+  T+ERY+K    A   N +     E+++   QQE  KL+ +  ++Q S R L+GE +G ++ KEL +LE +L+ S+ +IRS + + +   +  +Q +E  L   N+ L+ ++ E  + N ++ L P   +    + P Q Q   F
Sbjct:   18 GRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY-SNNSVKGTIERYKK----AISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPF 220          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL8_SOLLC3.524e-4453.14Agamous-like MADS-box protein AGL8 homolog OS=Sola... [more]
AGL8_ARATH7.851e-4452.81Agamous-like MADS-box protein AGL8 OS=Arabidopsis ... [more]
AGL8_SOLTU1.025e-4353.14Agamous-like MADS-box protein AGL8 homolog OS=Sola... [more]
AGL13_ARATH5.627e-4251.56Agamous-like MADS-box protein AGL13 OS=Arabidopsis... [more]
AGL8_SOLCO1.253e-4152.00Agamous-like MADS-box protein AGL8 homolog OS=Sola... [more]
MAD21_ORYSJ3.647e-4140.93MADS-box transcription factor 21 OS=Oryza sativa s... [more]
AGL1_ARATH5.266e-4047.09Agamous-like MADS-box protein AGL1 OS=Arabidopsis ... [more]
AG_PANGI4.458e-3944.78Floral homeotic protein AGAMOUS OS=Panax ginseng G... [more]
AG_BRANA7.605e-3944.23Floral homeotic protein AGAMOUS OS=Brassica napus ... [more]
AG_ARATH7.605e-3943.75Floral homeotic protein AGAMOUS OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top