FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AG_SOLLC (Floral homeotic protein AGAMOUS OS=Solanum lycopersicum GN=AG1 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.929e-38
Identity = 91/210 (43.33%), Postives = 136/210 (64.76%), Query Frame = 2
Query:    5 EMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK-CNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME----GYQVNTLQLNPSAEDCGYGLKPAQPQGDT 619
            ++GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVAL++FSNRG+LYE+ +++S+  T+ERY+K C+  +   +VS  EA     QQE  KL+A+   L    RN++GE L  +  KEL++LE++++  + +IRS + + +   +  +Q +E  L   N+ L+ ++ E     +Q   + L P +    + L P   Q DT
Sbjct:   16 KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEY-ANNSVKATIERYKKACSDSSNTGSVS--EANAQYYQQEASKLRAQIGNLMNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQKREVDLHNNNQYLRAKIAETERAQHQHQQMNLMPGSSSNYHELVPPPQQFDT 222          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AG_TOBAC (Floral homeotic protein AGAMOUS OS=Nicotiana tabacum GN=AG1 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.438e-38
Identity = 92/210 (43.81%), Postives = 136/210 (64.76%), Query Frame = 2
Query:    5 EMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK-CNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME----GYQVNTLQLNPSAEDCGYGLKPAQPQGDT 619
            ++GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS+RG+LYE+ +++S+  T+ERY+K C+  +   ++S  EA     QQE  KL+A+   LQ   RN+LGE L  L+ ++L++LE++++  + +IRS + + +   +  +Q +E  L   N+ L+ ++ E      Q    Q+N       Y L P   Q DT
Sbjct:   16 KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY-ANNSVKATIERYKKACSDSSNTGSIS--EANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERAQQQQQQQQMNLMPGSSSYELVPPPHQFDT 222          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AG_PETHY (Floral homeotic protein AGAMOUS OS=Petunia hybrida GN=AG1 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.438e-38
Identity = 89/204 (43.63%), Postives = 130/204 (63.73%), Query Frame = 2
Query:    5 EMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGD 616
            ++GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS+RG+LYE+ +++S+  T+ERY+K    +     S  EA     QQE  KL+A+   LQ   RN LGE L  LN ++L +LE++++  + +IR+ + + +   +  +Q +E  L   N+ L+ ++ E  +   + L P +    Y L P Q   D
Sbjct:   16 KLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY-ANNSVKATIERYKKACSDSSNTG-SIAEANAQYYQQEASKLRAQIGNLQNQNRNFLGESLAALNLRDLRNLEQKIEKGISKIRAKKNELLFAEIEYMQKREIDLHNNNQYLRAKIAETERSQQMNLMPGSS--SYDLVPPQQSFD 215          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL5_ARATH (Agamous-like MADS-box protein AGL5 OS=Arabidopsis thaliana GN=AGL5 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.873e-37
Identity = 84/178 (47.19%), Postives = 124/178 (69.66%), Query Frame = 2
Query:    2 EEMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQK-CNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            +++GRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVAL+IFS RG+LYE+ +++S+  T+ERY+K C+     P ++  EA     QQE  KL+ +   +Q   R++LGE LG LN KEL++LE +L+  + ++RS + + ++  +  +Q +E  L   N  L+ ++ E
Sbjct:   14 KKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEY-ANNSVRGTIERYKKACSDAVNPPTIT--EANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKREIELQNDNMYLRSKITE 188          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL11_ARATH (Agamous-like MADS-box protein AGL11 OS=Arabidopsis thaliana GN=AGL11 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.214e-36
Identity = 85/191 (44.50%), Postives = 128/191 (67.02%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL--MEGYQVNTLQLNPSAE 574
            MGRG++E+KRIEN  NRQVTF KRRNGLLKKAYELSVLCDAEVALI+FS RG+LYE+ +++++  T+ERY+K    +   + + +E      QQE  KL+ + + +Q S RNL+G+ L  L+ KEL+ +E +L+ ++ +IRS + + +L  +   Q +E  L   N  L+ ++  +E YQ +  Q+   +E
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEY-ANNNIRSTIERYKKACSDSTNTS-TVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVERYQQHHHQMVSGSE 189          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD58_ORYSJ (MADS-box transcription factor 58 OS=Oryza sativa subsp. japonica GN=MADS58 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.071e-36
Identity = 88/197 (44.67%), Postives = 128/197 (64.97%), Query Frame = 2
Query:    2 EEMG-RGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQ-VNTLQLNPSAEDCGY 586
            E++G RG++E+KRIEN  NRQVTF KRR+GLLKKAYELSVLCDAEVAL++FS+RG+LYE+ S++S+ +T+ERY+K N      +  A E      QQE  KLK +   LQ S R L+G+ +  +N +EL+ LE +LD  L +IR+ + + +   +  +Q +E  L   N  LK ++ E  + + T+ +  SA    Y
Sbjct:   40 EKIGSRGKIEIKRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEY-SNNSVKETIERYKKANSDTSNASTVA-EINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRARKNELLCAEIEYMQRRETELQNDNMYLKSKVAESERGLQTVNMMGSASTSEY 234          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD13_ORYSJ (MADS-box transcription factor 13 OS=Oryza sativa subsp. japonica GN=MADS13 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 6.025e-36
Identity = 80/183 (43.72%), Postives = 124/183 (67.76%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCN-----YGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQ 541
            MGRGR+E+KRIEN  +RQVTF KRRNGLLKKAYELSVLCDAEVALI+FS+RG+LYE+ +++++  T++RY+K +      GAP   V+A++      QQE  KL+ + + LQ + ++L+G+ +  L+ KEL+ LE +L+  + +IR+ + + +   +  +  +E  L   N  L+ ++ E  Q
Sbjct:    1 MGRGRIEIKRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNNNVKATIDRYKKAHACGSTSGAPLIEVNAQQYY----QQESAKLRHQIQMLQNTNKHLVGDNVSNLSLKELKQLESRLEKGISKIRARKNELLASEINYMAKREIELQNDNMDLRTKIAEEEQ 179          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL14_ARATH (Agamous-like MADS-box protein AGL14 OS=Arabidopsis thaliana GN=AGL14 PE=2 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 1.028e-35
Identity = 88/172 (51.16%), Postives = 114/172 (66.28%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQR 523
            M RG+ E+KRIEN  +RQVTF+KRRNGLLKKA+ELSVLCDAEVALIIFS RGKLYEF SSSS+ KT+ERYQK        +   R      S+ E   L  + E L+ S R ++GE L   + +EL+ LE QLD SL +IR+ + Q + +   +L+ KE+ L   NK L ++
Sbjct:    1 MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSSSSIPKTVERYQKRIQDLGSNH--KRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRAKKYQLLREETEKLKEKERNLIAENKMLMEK 170          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: GGM13_GNEGN (MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.290e-35
Identity = 87/179 (48.60%), Postives = 115/179 (64.25%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS-SSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQ---EYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRG++E+KRIEN  NRQVTF+KRR GLLKKA+ELSVLCDAE+ LIIFS+ GKL+E+ S SSSM K +ERYQK         VS     E  +Q    E  ++K   E LQ + R ++GE+L  L   EL  L +QL+ +  ++RS + Q ML  L  L+ KE++L + N  L + L E
Sbjct:    1 MGRGKIEIKRIENTTNRQVTFSKRRGGLLKKAHELSVLCDAELGLIIFSSSGKLFEYSSASSSMKKIIERYQK---------VSGARITEYDNQHLYCEMTRMKNENEKLQTNIRRMMGEDLTSLTMTELHHLGQQLESASSRVRSRKNQLMLQQLENLRRKERILEDQNSHLCRLLAE 170          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: SOC1_ARATH (MADS-box protein SOC1 OS=Arabidopsis thaliana GN=SOC1 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.990e-35
Identity = 90/217 (41.47%), Postives = 135/217 (62.21%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQ---EYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDT---FFHALEC 640
            M RG+ ++KRIEN  +RQVTF+KRRNGLLKKA+ELSVLCDAEV+LIIFS +GKLYEF +SS+M  T++RY +      +  VS +   E + Q    E   +  + E L+ S+R LLGE +G  + +EL+ +E+QL+ S+K IR+ +TQ   + + +L+ KE+ L+  N+ L ++   G   + +  N + E  G G + + P  +     F  L C
Sbjct:    1 MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEF-ASSNMQDTIDRYLR----HTKDRVSTKPVSEENMQHLKYEAANMMKKIEQLEASKRKLLGEGIGTCSIEELQQIEQQLEKSVKCIRARKTQVFKEQIEQLKQKEKALAAENEKLSEKW--GSHESEVWSNKNQESTGRGDEESSPSSEVETQLFIGLPC 210          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AG_SOLLC4.929e-3843.33Floral homeotic protein AGAMOUS OS=Solanum lycoper... [more]
AG_TOBAC6.438e-3843.81Floral homeotic protein AGAMOUS OS=Nicotiana tabac... [more]
AG_PETHY6.438e-3843.63Floral homeotic protein AGAMOUS OS=Petunia hybrida... [more]
AGL5_ARATH1.873e-3747.19Agamous-like MADS-box protein AGL5 OS=Arabidopsis ... [more]
AGL11_ARATH1.214e-3644.50Agamous-like MADS-box protein AGL11 OS=Arabidopsis... [more]
MAD58_ORYSJ2.071e-3644.67MADS-box transcription factor 58 OS=Oryza sativa s... [more]
MAD13_ORYSJ6.025e-3643.72MADS-box transcription factor 13 OS=Oryza sativa s... [more]
AGL14_ARATH1.028e-3551.16Agamous-like MADS-box protein AGL14 OS=Arabidopsis... [more]
GGM13_GNEGN2.290e-3548.60MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 P... [more]
SOC1_ARATH2.990e-3541.47MADS-box protein SOC1 OS=Arabidopsis thaliana GN=S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top