FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL12_ARATH (Agamous-like MADS-box protein AGL12 OS=Arabidopsis thaliana GN=AGL12 PE=2 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 1.176e-31
Identity = 76/181 (41.99%), Postives = 111/181 (61.33%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKC---NYGAPEPNVSAREALE---LSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            M RG+++LKRIEN ++RQVTF KRR GLLKKA ELSVLCDAE+ ++IFS +GKL+E  +  +M   +++Y KC     G+     +A+E L+   L  + E   LK   E LQ+    + G   G +N +EL  LE+ L+  + QIRS +   ML  +  L++KE +L   NK L +++ E
Sbjct:    1 MARGKIQLKRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFELATKGTMEGMIDKYMKCTGGGRGSSSATFTAQEQLQPPNLDPKDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEE 181          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD25_ORYSJ (MADS-box transcription factor 25 OS=Oryza sativa subsp. japonica GN=MADS25 PE=2 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 3.421e-31
Identity = 74/182 (40.66%), Postives = 116/182 (63.74%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS--QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 547
            MGRG++ +KRI+N +NRQVTF+KRR GL+KKA EL++LCDA+V LI+FS  G+LY+F SSSSM   +ERYQ+    A E +      +  +   Q+E   L+ + + L  + R LLGEE+     ++L+ L+ Q++MSL  IR+ + Q + + + +L  K  L+ + N  L+++    +Q N
Sbjct:    1 MGRGKIAIKRIDNTMNRQVTFSKRRGGLMKKARELAILCDADVGLIVFSCTGRLYDF-SSSSMKSIIERYQE----AGEEHCRLLNPMSEAKFWQREVTTLRQQVQNLHHNNRQLLGEEISNFTVRDLQLLQNQVEMSLHSIRNKKDQLLAEEILKLNEKGSLVQKENSELRKKFNIAHQRN 177          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD23_ORYSJ (MADS-box transcription factor 23 OS=Oryza sativa subsp. japonica GN=MADS23 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.421e-31
Identity = 74/158 (46.84%), Postives = 107/158 (67.72%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHK 481
            MGRG++E+KRI+N  +RQVTF+KRR+GL KKA ELS+LCDAEV L++FS+  +LY+F +SSSM   +ERY +     P   ++A    +L  QQE   L+ +   LQ   R LLG++L  L+ ++L++LE +L+MSLK IR  +   M+D + EL  K
Sbjct:    1 MGRGKIEIKRIDNATSRQVTFSKRRSGLFKKARELSILCDAEVGLLVFSSTSRLYDF-ASSSMKSIIERYNETKED-PHQTMNASSEAKL-WQQEAASLRQQLHNLQEYHRQLLGQQLSGLDVEDLQNLESKLEMSLKNIRLRKDNVMMDQIQELSRK 155          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL17_ARATH (Agamous-like MADS-box protein AGL17 OS=Arabidopsis thaliana GN=AGL17 PE=2 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 9.955e-31
Identity = 78/181 (43.09%), Postives = 114/181 (62.98%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS-QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 547
            MGRG++ +++I++  +RQVTF+KRR GL+KKA EL++LCDAEV LIIFSN  KLY+F +SSS+  T+ER+   N    E       A E+   Q+E   L+    +LQ + R L G EL  L+ KEL+++E QL+MSL+ IR  R Q + + + EL  K  L+   N  L +++   +Q N
Sbjct:    1 MGRGKIVIQKIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVCLIIFSNTDKLYDF-ASSSVKSTIERF---NTAKMEEQELMNPASEVKFWQREAETLRQELHSLQENYRQLTGVELNGLSVKELQNIESQLEMSLRGIRMKREQILTNEIKELTRKRNLVHHENLELSRKVQRIHQEN 177          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: M17_MAIZE (MADS-box protein ZMM17 OS=Zea mays GN=M17 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.300e-30
Identity = 75/180 (41.67%), Postives = 112/180 (62.22%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKC-NYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQ 541
            MGRG++E+KRIEN  NRQVTF+KRR GLLKKA EL+VLCDA V ++IFS+ GK++E+CS +  L+ L E+YQ   N    E N   +  LE++      ++K   E L+   R   G++L  L   ++  LE+QL+ S+ ++R+ + Q +   L  L+ KEQ+L + N  L + + E  Q
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCSPACSLRELIEQYQHATNSHFEEINHDQQILLEMT------RMKNEMEKLETGIRRYTGDDLSSLTLDDVSDLEQQLEYSVSKVRARKHQLLNQQLDNLRRKEQILEDQNTFLYRMINENQQ 174          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL15_ARATH (Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana GN=AGL15 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.300e-30
Identity = 79/175 (45.14%), Postives = 113/175 (64.57%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRG++E+KRIEN  +RQVTF+KRR+GLLKKA ELSVLCDAEVA+I+FS  GKL+E+ SS+ M +TL RY   N+ +   + +  +  E+        LK +   LQ     L G+ L PL  KEL+SLE+QL  +L  +R  + + + + L E + KEQ     N+TL++++ E
Sbjct:    1 MGRGKIEIKRIENANSRQVTFSKRRSGLLKKARELSVLCDAEVAVIVFSKSGKLFEY-SSTGMKQTLSRYG--NHQSSSASKAEEDCAEVDI------LKDQLSKLQEKHLQLQGKGLNPLTFKELQSLEQQLYHALITVRERKERLLTNQLEESRLKEQRAELENETLRRQVQE 166          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD57_ORYSJ (MADS-box transcription factor 57 OS=Oryza sativa subsp. japonica GN=MADS57 PE=2 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.698e-30
Identity = 74/174 (42.53%), Postives = 110/174 (63.22%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSS-QQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGRG++ ++RI+N  +RQVTF+KRRNGLLKKA ELS+LCDAEV L++FS+ G+LYEF SS++M   ++RY      A E  +      E+   Q+E   L+ +   LQ S + L+GEEL  L  ++L+ LE +L++SL+ IR  +   +   + EL  K  L+ + N  L + L
Sbjct:    1 MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLVVFSSTGRLYEF-SSTNMKTVIDRYT----NAKEELLGGNATSEIKIWQREAASLRQQLHNLQESHKQLMGEELSGLGVRDLQGLENRLEISLRNIRMRKDNLLKSEIEELHVKGSLIHQENIELSRSL 169          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: FBP24_PETHY (MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.877e-29
Identity = 76/175 (43.43%), Postives = 110/175 (62.86%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS-SSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLM 529
            MGRG++E+KRIENK +RQVTF+KRR GLLKK +ELSVLCDA++ LIIFS++GKL+E+CS   SM + + RY +   GA  P    R  L      E  K++     LQ S +   G++L     +EL  LE+QL+ +L +IR+ + + M   +  L+  E++L + N  + Q LM
Sbjct:    4 MGRGKIEVKRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSKGKLFEYCSQPHSMSQIISRYLQTT-GASLPVEDNRVQL----YDEVAKMRRDTLNLQLSLQRYKGDDLSLAQYEELNELEKQLEHALNKIRARKLELMQQQMENLKKTEKMLEKENHDMYQWLM 173          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: FLC_ARATH (MADS-box protein FLOWERING LOCUS C OS=Arabidopsis thaliana GN=FLC PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.452e-29
Identity = 72/192 (37.50%), Postives = 114/192 (59.38%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNT---LQLNPSAE 574
            MGR ++E+KRIENK +RQVTF+KRRNGL++KA +LSVLCDA VAL++ S  GKLY F S  +++K L+RY K +         A +   L  Q + L   + YE L+     L+G  +  ++   L  LE  L+ +L   R+ +T+ ML  +  L+ KE++L E N+ L  ++   + V     ++++P+ +
Sbjct:    1 MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGDNLVKILDRYGKQH---------ADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSPAGQ 183          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD26_ORYSJ (MADS-box transcription factor 26 OS=Oryza sativa subsp. japonica GN=MADS26 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.202e-29
Identity = 70/176 (39.77%), Postives = 110/176 (62.50%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGP-LNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            M RG+V+L+RIEN ++RQVTF KRR GLLKKA ELS+LC+A++ +IIFS  GKLY+  ++ +M + +ERY+     A     +A     +  +QE + LK     LQ+  R + G      +  +EL +LER L++ +  IRS + Q M+  +  L+ KE +L  AN+ L+++++E
Sbjct:    1 MARGKVQLRRIENPVHRQVTFCKRRAGLLKKARELSILCEADIGIIIFSAHGKLYDLATTGTMEELIERYK----SASGEQANACGDQRMDPKQEAMVLKQEINLLQKGLRYIYGNRANEHMTVEELNALERYLEIWMYNIRSAKMQIMIQEIQALKSKEGMLKAANEILQEKIVE 172          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL12_ARATH1.176e-3141.99Agamous-like MADS-box protein AGL12 OS=Arabidopsis... [more]
MAD25_ORYSJ3.421e-3140.66MADS-box transcription factor 25 OS=Oryza sativa s... [more]
MAD23_ORYSJ3.421e-3146.84MADS-box transcription factor 23 OS=Oryza sativa s... [more]
AGL17_ARATH9.955e-3143.09Agamous-like MADS-box protein AGL17 OS=Arabidopsis... [more]
M17_MAIZE1.300e-3041.67MADS-box protein ZMM17 OS=Zea mays GN=M17 PE=2 SV=... [more]
AGL15_ARATH1.300e-3045.14Agamous-like MADS-box protein AGL15 OS=Arabidopsis... [more]
MAD57_ORYSJ1.698e-3042.53MADS-box transcription factor 57 OS=Oryza sativa s... [more]
FBP24_PETHY1.877e-2943.43MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24... [more]
FLC_ARATH2.452e-2937.50MADS-box protein FLOWERING LOCUS C OS=Arabidopsis ... [more]
MAD26_ORYSJ3.202e-2939.77MADS-box transcription factor 26 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top