FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD26_ORYSI (MADS-box transcription factor 26 OS=Oryza sativa subsp. indica GN=MADS26 PE=2 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 3.202e-29
Identity = 70/176 (39.77%), Postives = 110/176 (62.50%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGP-LNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            M RG+V+L+RIEN ++RQVTF KRR GLLKKA ELS+LC+A++ +IIFS  GKLY+  ++ +M + +ERY+     A     +A     +  +QE + LK     LQ+  R + G      +  +EL +LER L++ +  IRS + Q M+  +  L+ KE +L  AN+ L+++++E
Sbjct:    1 MARGKVQLRRIENPVHRQVTFCKRRAGLLKKARELSILCEADIGIIIFSAHGKLYDLATTGTMEELIERYK----SASGEQANACGDQRMDPKQEAMVLKQEINLLQKGLRYIYGNRANEHMTVEELNALERYLEIWMYNIRSAKMQIMIQEIQALKSKEGMLKAANEILQEKIVE 172          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD29_ORYSJ (MADS-box transcription factor 29 OS=Oryza sativa subsp. japonica GN=MADS29 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.076e-28
Identity = 71/182 (39.01%), Postives = 108/182 (59.34%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKCNYGAPEPNVSAREALELSSQQ----EYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGY 538
            MGRG++E+KRIEN  NRQVTF+KRR GLLKKA EL+VLCDA V ++IFS+ GK++E+CS +  L+ L E YQ          V+     E++  Q    E  +++   E L    R   G++L  L   ++  LE+QL+ S+ ++R+ + Q +   L  L+ KE +L + N  L + + E +
Sbjct:    1 MGRGKIEIKRIENATNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCSPTCSLRELIEHYQ---------TVTNTHFEEINHDQQIFVEMTRMRNEMEKLDGGIRRFTGDDLSNLTLADINDLEQQLEFSVTKVRARKHQLLNQQLDNLRRKEHILEDQNSFLCRMINENH 173          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.541e-28
Identity = 70/172 (40.70%), Postives = 109/172 (63.37%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQR 523
            M R ++++++I+N   RQVTF+KRR GL KKA ELSVLCDA+VALIIFS+ GKL+EFC SSSM + LER+   +    + +  + E L+L    ++ ++           R + GEEL  L+ +EL+ LE+ L+  L ++  T++  ++  ++ELQ K   L + NK L+Q+
Sbjct:    1 MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFC-SSSMKEVLERHNLQSKNLEKLDQPSLE-LQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQ 170          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: JOIN_SOLLC (MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.624e-28
Identity = 73/175 (41.71%), Postives = 107/175 (61.14%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            M R ++++K+I+N   RQVTF+KRR GL KKA ELSVLCDA+VALIIFS+ GKL+++ SSSSM + LER    +    + +  + E L+L     Y +L           R + GEEL  LN +EL+ LER L+  L ++   +   ++  + +LQ K   L E N+ L+Q++ME
Sbjct:    1 MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDY-SSSSMKQILERRDLHSKNLEKLDQPSLE-LQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLNIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVME 173          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: DEF21_ANTMA (MADS-box protein defh21 OS=Antirrhinum majus GN=DEFH21 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.624e-28
Identity = 69/176 (39.20%), Postives = 110/176 (62.50%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS-SMLKTLERYQKCNYGAPE-PNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLM 529
            MGRG++E+KRIEN  +RQVTF+KRR+GL+KK +ELSVLCDA++ LI+FS +GKL E+C+   SM + ++RY K     PE  N +   A      +E  ++K     LQ + +   G++L  +  +EL  LE+ LD SL ++R+ + + + + +  L+  E +L + N+ +   LM
Sbjct:    1 MGRGKIEVKRIENNTSRQVTFSKRRSGLMKKTHELSVLCDAQIGLIVFSTKGKLTEYCTPPFSMKQIIDRYVKAKGILPEMENRAGPHADNDQVIKELTRMKEETLNLQLNLQRYKGDDLSTVRFEELTELEKLLDQSLNKVRARKLELLHEQMENLKRTEFMLEKENQEMYHWLM 176          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS2_PETHY (Floral homeotic protein PMADS 2 OS=Petunia hybrida GN=PMADS2 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.915e-27
Identity = 73/178 (41.01%), Postives = 109/178 (61.24%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSML-KTLERYQKCN----YGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGRG++E+KRIEN  NRQVT++KRRNG++KKA E++VLCDA+V+LIIF N GK++E+CS S+ L   L+ YQK +    + A   N+S           E  ++K   + +Q   R+L GE++  LN KEL  LE  L   L  I + ++    + L  ++  +Q+L E +K L+  L
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCSPSTTLPDMLDGYQKTSGRRLWDAKHENLS----------NEIDRIKKENDNMQVKLRHLKGEDINSLNHKELMVLEEGLTNGLSSISAKQS----EILRMVRKNDQILEEEHKQLQYAL 164          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS2_ORYSJ (MADS-box transcription factor 2 OS=Oryza sativa subsp. japonica GN=MADS2 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.139e-26
Identity = 76/202 (37.62%), Postives = 114/202 (56.44%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS-SSSMLKTLERYQ----KCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKP 598
            MGRG++E+KRIEN  NRQVTF+KRR+G+LKKA E+SVLCDAEV ++IFS+ GKLY++CS  +S+ + LE+YQ    K  +     ++SA          E  ++K   + +Q   R+L GE+L  L  KEL  +E  LD  +  +       ++D        +++L + NK L  +L +      + L+ S  D   G  P
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFSKRRSGILKKAREISVLCDAEVGVVIFSSAGKLYDYCSPKTSLSRILEKYQTNSGKILWDEKHKSLSA----------EIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGIVNVNDK----LMDHWERHVRTDKMLEDENKLLAFKLHQ----QDIALSGSMRDLELGYHP 184          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD16_ORYSJ (MADS-box transcription factor 16 OS=Oryza sativa subsp. japonica GN=MADS16 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.537e-26
Identity = 75/175 (42.86%), Postives = 109/175 (62.29%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLS-EANKTLKQRL 526
            MGRG++E+KRIEN  NRQVT++KRR G++KKA EL+VLCDA+VA+I+FS+ GK +EFCS S+ +K + +RYQ+          S       + Q+    LK     L+   R  +GE+L  L   EL  LE+ +D +LK++R  R  +++ T TE   K+   S EA +TL+Q L
Sbjct:    1 MGRGKIEIKRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCSPSTDIKGIFDRYQQA------IGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDGLEFDELRGLEQNVDAALKEVRH-RKYHVITTQTETYKKKVKHSYEAYETLQQEL 168          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: PIST_ARATH (Floral homeotic protein PISTILLATA OS=Arabidopsis thaliana GN=PI PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.314e-26
Identity = 73/210 (34.76%), Postives = 119/210 (56.67%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSML-KTLERYQKCN----YGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL-----KQRLMEGYQVNTLQLNPSAEDCGYGLKPAQP 607
            MGRG++E+KRIEN  NR VTF+KRRNGL+KKA E++VLCDA+VALIIF++ GK+ ++C  S  L   L++YQK +    + A   N+S           E  ++K   ++LQ   R+L GE++  LN K L ++E  ++  L ++R     + ++ L   +  E++++E  + L     +Q +        + +       GY ++P QP
Sbjct:    1 MGRGKIEIKRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMIDYCCPSMDLGAMLDQYQKLSGKKLWDAKHENLS----------NEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVR----DHQMEILISKRRNEKMMAEEQRQLTFQLQQQEMAIASNARGMMMRDHDGQFGYRVQPIQP 196          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: GLOB_TOBAC (Floral homeotic protein GLOBOSA OS=Nicotiana tabacum GN=GLO PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.314e-26
Identity = 72/175 (41.14%), Postives = 106/175 (60.57%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRG++E+KRIEN  NRQVT++KRRNG+LKKA E+SVLCDA V++IIF++ GK++EF SS+S++  L++Y K             +A   +   E  K+K   + +Q   R+L GE++  LN +EL  LE  LD  L  IR+ +     D L  ++ K Q + E    L  +L +
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEF-SSTSLVDILDQYHKLT------GRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMMLEDALDNGLTSIRNKQN----DLLRMMRKKTQSMEEEQDQLNWQLRQ 164          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
MAD26_ORYSI3.202e-2939.77MADS-box transcription factor 26 OS=Oryza sativa s... [more]
MAD29_ORYSJ2.076e-2839.01MADS-box transcription factor 29 OS=Oryza sativa s... [more]
SVP_ARATH3.541e-2840.70MADS-box protein SVP OS=Arabidopsis thaliana GN=SV... [more]
JOIN_SOLLC4.624e-2841.71MADS-box protein JOINTLESS OS=Solanum lycopersicum... [more]
DEF21_ANTMA4.624e-2839.20MADS-box protein defh21 OS=Antirrhinum majus GN=DE... [more]
MADS2_PETHY3.915e-2741.01Floral homeotic protein PMADS 2 OS=Petunia hybrida... [more]
MADS2_ORYSJ1.139e-2637.62MADS-box transcription factor 2 OS=Oryza sativa su... [more]
MAD16_ORYSJ2.537e-2642.86MADS-box transcription factor 16 OS=Oryza sativa s... [more]
PIST_ARATH3.314e-2634.76Floral homeotic protein PISTILLATA OS=Arabidopsis ... [more]
GLOB_TOBAC3.314e-2641.14Floral homeotic protein GLOBOSA OS=Nicotiana tabac... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top