FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: FBP1_PETHY (Floral homeotic protein FBP1 OS=Petunia hybrida GN=FBP1 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.314e-26
Identity = 70/174 (40.23%), Postives = 108/174 (62.07%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQ---QEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQ 520
            MGRG++E+KRIEN  NRQVT++KRRNG+LKKA E+SVLCDA V++IIF++ GK++EF SS+S++  L++Y K         ++ R  L+   +    E  K+K   + +Q   R+L GE++  LN +EL  LE  L+  L  IR+ + + +     + Q  E+   + N  L+Q
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEF-SSTSLVDILDQYHK---------LTGRRLLDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMILEDALENGLTSIRNKQNEVLRMMRKKTQSMEEEQDQLNCQLRQ 164          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: TT16_ARATH (Protein TRANSPARENT TESTA 16 OS=Arabidopsis thaliana GN=TT16 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.653e-26
Identity = 78/212 (36.79%), Postives = 114/212 (53.77%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSS-MLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALEC 640
            MGRG++E+K+IEN+  RQVTF+KRR GL+KK  ELS+LCDA + LI+FS  GKL EFCS  + M + ++RY   N G   P+    +  +L  + E L+ +     L+   R   G +L  +   EL+ LERQL+ S+ ++R  + + M   L  L  K ++L E N  + + L E       Q        G   KP + Q   F   L+C
Sbjct:    1 MGRGKIEIKKIENQTARQVTFSKRRTGLIKKTRELSILCDAHIGLIVFSATGKLSEFCSEQNRMPQLIDRYLHTN-GLRLPD-HHDDQEQLHHEMELLRRETC--NLELRLRPFHGHDLASIPPNELDGLERQLEHSVLKVRERKNELMQQQLENLSRKRRMLEEDNNNMYRWLHEHRAAMEFQ------QAGIDTKPGEYQ--QFIEQLQC 200          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD22_ORYSJ (MADS-box transcription factor 22 OS=Oryza sativa subsp. japonica GN=MADS22 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.653e-26
Identity = 71/176 (40.34%), Postives = 107/176 (60.80%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELS-SQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            M R R E+KRIE+   RQVTF+KRR GL KKA ELSVLCDA+VALI+FS+ GKL  F +SSSM + +++Y   N  +     + + +L+L+    +Y  L  +        R + GEEL  L+  EL+ LE+ L+  L ++  T+ Q  ++ ++ELQ K   L+E N  L+ ++ +
Sbjct:    1 MARERREIKRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSHF-ASSSMNEIIDKY---NTHSNNLGKAEQPSLDLNLEHSKYAHLNEQLAEASLRLRQMRGEELEGLSIDELQQLEKNLEAGLHRVMLTKDQQFMEQISELQRKSSQLAEENMQLRNQVSQ 172          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL31_ARATH (Agamous-like MADS-box protein AGL31 OS=Arabidopsis thaliana GN=AGL31 PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 5.653e-26
Identity = 70/174 (40.23%), Postives = 107/174 (61.49%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQ-QEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            MGR +VE+KRIENK +RQVTF+KRRNGL++KA +LS+LC++ +A+++ S  GKLY+  S  +M K ++RY+         +    EAL+L+ + + YL LK   E L+  Q  L    +   +   L SLE QL+ +L   R+ +T+ M+  +  LQ  E LL E N+TL  ++
Sbjct:    1 MGRKKVEIKRIENKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYKSASGDNMSKIIDRYE-------IHHADELEALDLAEKTRNYLPLK---ELLEIVQSKLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQV 164          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: GLOB_ANTMA (Floral homeotic protein GLOBOSA OS=Antirrhinum majus GN=GLO PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.785e-25
Identity = 64/179 (35.75%), Postives = 113/179 (63.13%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS-SSSMLKTLERYQKCNYGAPEPNVSAREALELSSQ---QEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLME 532
            MGRG++E+KRIEN  NRQVT++KRRNG++KKA E+SVLCDA V++IIF++ GK++EFCS S++++  L+ Y K         +S +   +   +    E  ++K   +++Q   R+L GE++  LN KEL  LE  L+     +++ + ++    +  ++   +++ E N++L+ +L +
Sbjct:    1 MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSPSTTLVDMLDHYHK---------LSGKRLWDPKHEHLDNEINRVKKENDSMQIELRHLKGEDITTLNYKELMVLEDALENGTSALKNKQMEF----VRMMRKHNEMVEEENQSLQFKLRQ 166          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD47_ORYSJ (MADS-box transcription factor 47 OS=Oryza sativa subsp. japonica GN=MADS47 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 8.163e-25
Identity = 67/187 (35.83%), Postives = 104/187 (55.61%), Query Frame = 2
Query:   14 RGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAE 574
            R R+ ++RI+N   RQVTF+KRR GL KKA ELS+LCDAEV L++FS  GKL++F +S+SM + ++RY   +        S  + L+        +LK          R + GEEL  LN ++L+ LE+ L+  L  +  T+++ +LD +  L+ K   L E N  LK++L         ++ P  +
Sbjct:   22 RERIAIRRIDNLAARQVTFSKRRRGLFKKAEELSILCDAEVGLVVFSATGKLFQF-ASTSMEQIIDRYNSHSKTLQRAEPSQLD-LQGEDSSTCARLKEELAETSLRLRQMRGEELHRLNVEQLQELEKSLESGLGSVLKTKSKKILDEIDGLERKRMQLIEENLRLKEQLQVSRMSRMEEMQPGPD 206          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS1_PETHY (Floral homeotic protein PMADS 1 OS=Petunia hybrida GN=PMADS1 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.392e-24
Identity = 68/170 (40.00%), Postives = 102/170 (60.00%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTL 514
            M RG++++KRIEN+ NRQVT++KRRNGL KKA EL+VLCDA+V++I+ S+ GKL+EF S S   K L + YQK         V    +     Q++  KLK     L++  R  +GE L  LN ++LE L   +D SLK IR  + + + + +   + K + + E ++ L
Sbjct:    1 MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFDLYQK------TVGVDLWNSHYEKMQEQLRKLKEVNRNLRKEIRQRMGESLNDLNYEQLEELMENVDNSLKLIRERKYKVIGNQIETFKKKVRNVEEIHRNL 164          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD31_ORYSJ (MADS-box transcription factor 31 OS=Oryza sativa subsp. japonica GN=MADS31 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.818e-24
Identity = 63/159 (39.62%), Postives = 98/159 (61.64%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTL-ERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHK 481
            MGRGRVELK+IEN  NRQVTF+KRR GLLKKA EL++LCDA++ +I+FS  GK+YE+ S    +  + +RY K    AP       + ++    QE  ++K     L+   R  +G++L  L  +++ +LE+Q++ SL ++R  + Q +   L E+  +
Sbjct:    1 MGRGRVELKKIENPTNRQVTFSKRRMGLLKKANELAILCDAQIGVIVFSGTGKMYEYSSPPWRIANIFDRYLK----APSTRFEEMD-VQQRIIQEMTRMKDENNRLRIIMRQYMGDDLASLTLQDVSNLEQQIEFSLYKVRLRKQQLLDQQLLEMHSR 154          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD30_ORYSJ (MADS-box transcription factor 30 OS=Oryza sativa subsp. japonica GN=MADS30 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.051e-24
Identity = 61/185 (32.97%), Postives = 107/185 (57.84%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNS-KELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL 559
            MG+G++E+KRIE+   RQVTF+KRR G LKKA EL+VLCDA+V +++FS++GKL++FCS   +L  +E + +         +      +     E  +L+   + L+ S R   GE+L  +++  EL  L+ QL+ SL ++ + + + M   L +++   Q + E N  L + + +   +N + +
Sbjct:    1 MGQGKIEMKRIEDATRRQVTFSKRRAGFLKKANELAVLCDAQVGVVVFSDKGKLFDFCSPPVIL--MELFHRYEITTRNTRLQETNRDDEQMVMEITRLRNEIDQLEASLRRQTGEDLSSVSTVDELSQLQLQLESSLSKVHARKDELMSQQLEDMRRMHQTVHEQNNFLCRMVTKILLLNVITI 183          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MAD55_ORYSJ (MADS-box transcription factor 55 OS=Oryza sativa subsp. japonica GN=MADS55 PE=2 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 5.850e-23
Identity = 70/194 (36.08%), Postives = 113/194 (58.25%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERY--QKCNYGA--PEPNV--------------SAREALELSSQQEYLKLKARYEALQRSQ---RNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRL 526
            M R R E++RIE+   RQVTF+KRR GL KKA EL+VLCDA+VAL++FS+ GKL +F +SS+M + +++Y     N G    +P++              ++   + L  Q E+ K  +  E L  +    R + GEEL  L+ +EL+ +E+ L+  L+++  T+ Q  +  ++ELQ K   L+E N  L+ ++
Sbjct:    1 MARERREIRRIESAAARQVTFSKRRRGLFKKAEELAVLCDADVALVVFSSTGKLSQF-ASSNMNEIIDKYTTHSKNLGKTDKQPSIDLNFFLIILLRTYTNSYAYIHLLLQLEHSKCSSLNEQLAEASLQLRQMRGEELEGLSVEELQQMEKNLEAGLQRVLCTKDQQFMQEISELQRKGIQLAEENMRLRDQM 193          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
FBP1_PETHY3.314e-2640.23Floral homeotic protein FBP1 OS=Petunia hybrida GN... [more]
TT16_ARATH5.653e-2636.79Protein TRANSPARENT TESTA 16 OS=Arabidopsis thalia... [more]
MAD22_ORYSJ5.653e-2640.34MADS-box transcription factor 22 OS=Oryza sativa s... [more]
AGL31_ARATH5.653e-2640.23Agamous-like MADS-box protein AGL31 OS=Arabidopsis... [more]
GLOB_ANTMA4.785e-2535.75Floral homeotic protein GLOBOSA OS=Antirrhinum maj... [more]
MAD47_ORYSJ8.163e-2535.83MADS-box transcription factor 47 OS=Oryza sativa s... [more]
MADS1_PETHY1.392e-2440.00Floral homeotic protein PMADS 1 OS=Petunia hybrida... [more]
MAD31_ORYSJ1.818e-2439.62MADS-box transcription factor 31 OS=Oryza sativa s... [more]
MAD30_ORYSJ4.051e-2432.97MADS-box transcription factor 30 OS=Oryza sativa s... [more]
MAD55_ORYSJ5.850e-2336.08MADS-box transcription factor 55 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top