FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK32_ARATH (Putative cysteine-rich receptor-like protein kinase 32 OS=Arabidopsis thaliana GN=CRK32 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.716e-51
Identity = 97/223 (43.50%), Postives = 148/223 (66.37%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP---------KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +  L  AT  F     LG GGFG VY+G LP ++ E+AVK++S  S QG +EF  E+V + +L+H+NLV+LLG+C  + E +LVY+++PN SL+ +L+            K  L+W++RY +I G+  GLLYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR +    T+  T  VVGT GY+ PE+   G+ +T +DV+SFG  +LE+ CG++
Sbjct:  308 QFDFMTLEAATDKFSRNNKLGKGGFGEVYKGMLP-NETEVAVKRLSSNSGQGTQEFKNEVVIVAKLQHKNLVRLLGFCLERDEQILVYEFVPNKSLNYFLFGNKQKHLLDPTKKSQLDWKRRYNIIGGITRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKIADFGMARNFRVDQTEDNTRRVVGTFGYMPPEYVTHGQFSTKSDVYSFGVLILEIVCGKK 529          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK20_ARATH (Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.716e-51
Identity = 99/215 (46.05%), Postives = 148/215 (68.84%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP-KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F     LG GGFG VY+GT P S +++AVK++S  S QG KEF  E+V + +L+HRNLV+LLGYC    E +LVY+++PN SLD +L++   +  L+W +RY +I G+A G+LYLH++    +IHRD+KA N+LLD ++N ++ DFG+AR++    T+  T  VVGT GY+APE++  GK +  +DV+SFG  +LE+  G +
Sbjct:  331 QFDFKAIVAATDIFLPINKLGQGGFGEVYKGTFP-SGVQVAVKRLSKNSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDYFLFDPTMQGQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGKFSMKSDVYSFGVLVLEIVSGMK 544          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK14_ARATH (Cysteine-rich receptor-like protein kinase 14 OS=Arabidopsis thaliana GN=CRK14 PE=2 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.716e-51
Identity = 95/214 (44.39%), Postives = 147/214 (68.69%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            +F +K +  AT  F E  ++G GGFG V+ G L  +  E+A+K++S  SRQG +EF  E+V + +L HRNLV+LLG+C    E +LVY+++PN SLD +L++  K   L+W +RY +I+G+  G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    +   T  + GT GY+ PE+ R G+ +T +DV+SFG  +LE+ CGR
Sbjct:  324 QFDFKAIEDATNKFSESNIIGRGGFGEVFMGVL--NGTEVAIKRLSKASRQGAREFKNEVVVVAKLHHRNLVKLLGFCLEGEEKILVYEFVPNKSLDYFLFDPTKQGQLDWTKRYNIIRGITRGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGIDQSGANTKKIAGTRGYMPPEYVRQGQFSTRSDVYSFGVLVLEIICGR 535          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK15_ARATH (Cysteine-rich receptor-like protein kinase 15 OS=Arabidopsis thaliana GN=CRK15 PE=2 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 4.854e-51
Identity = 100/212 (47.17%), Postives = 145/212 (68.40%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            Y+ +  AT  F E   +G GGFG VY+GT      E+AVK++S  S QG  EF  E+V + +L+HRNLV+LLG+    GE +LVY+YMPN SLD +L++  K   L+W +RY VI G+A G+LYLH++    +IHRD+KASN+LLD ++N +L DFGLAR++    T   T+ +VGT GY+APE++  G+ +  +DV+SFG  +LE+  G++
Sbjct:  327 YRMIRAATNKFSENNKIGQGGFGEVYKGTFSNGT-EVAVKRLSKSSGQGDTEFKNEVVVVAKLQHRNLVRLLGFSIGGGERILVYEYMPNKSLDYFLFDPAKQNQLDWTRRYKVIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKLADFGLARIFGMDQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLVLEIISGKK 537          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK30_ARATH (Putative cysteine-rich receptor-like protein kinase 30 OS=Arabidopsis thaliana GN=CRK30 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.339e-51
Identity = 98/218 (44.95%), Postives = 145/218 (66.51%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT----LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLY-DHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F  KD+  AT  F     +G GGFG VY+GTL     E+AVK++S  S QG  EF  E++ + +L+HRNLV+LLG+  +  E +LV++++PN SLD +L+     T    L+W +RY +I G+  GLLYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR + DH T+  T  VVGT GY+ PE+   G+ +T +DV+SFG  +LE+  GR+
Sbjct:  333 QFDIKDIEAATSNFLASNKIGQGGFGEVYKGTLSNGT-EVAVKRLSRTSDQGELEFKNEVLLVAKLQHRNLVRLLGFALQGEEKILVFEFVPNKSLDYFLFGSTNPTKKGQLDWTRRYNIIGGITRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKIADFGMARNFRDHQTEDSTGRVVGTFGYMPPEYVAHGQFSTKSDVYSFGVLILEIVSGRK 549          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK19_ARATH (Cysteine-rich receptor-like protein kinase 19 OS=Arabidopsis thaliana GN=CRK19 PE=2 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 6.339e-51
Identity = 98/215 (45.58%), Postives = 149/215 (69.30%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQP-KVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F     LG GGFG VY+GTL  S +++AVK++S  S QG KEF  E+V + +L+HRNLV+LLGYC    E +LVY+++PN SLD +L++   K+ L+W +RY +I G+A G+LYLH++    +IHRD+KA N+LLD ++N ++ DFG+AR++    T+  T  VVGT GY++PE++  G+ +  +DV+SFG  +LE+  G +
Sbjct:  313 QFDFKAIEAATNCFLPINKLGQGGFGEVYKGTL-SSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMK 526          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK40_ARATH (Cysteine-rich receptor-like protein kinase 40 OS=Arabidopsis thaliana GN=CRK40 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.081e-50
Identity = 99/215 (46.05%), Postives = 146/215 (67.91%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVTL-NWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHG-TDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            RF    + +AT  F  +  LG GGFG VY+GT P  + E+AVK+++  S QG  EF  E+  + RL+H+NLV+LLG+C    E +LVY+++PN SLD +++++ K +L  W  R+ +I+G+A GLLYLHE+ +  +IHRD+KASN+LLD E+N ++ DFG ARL+D   T  +T  + GT GY+APE+   G+ +  +DV+SFG  LLE+  G R
Sbjct:  335 RFDLGMIVMATDDFSSENTLGQGGFGTVYKGTFPNGQ-EVAVKRLTKGSGQGDMEFKNEVSLLTRLQHKNLVKLLGFCNEGDEEILVYEFVPNSSLDHFIFDEDKRSLLTWEVRFRIIEGIARGLLYLHEDSQLKIIHRDLKASNILLDAEMNPKVADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGER 548          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK5_ARATH (Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.412e-50
Identity = 96/215 (44.65%), Postives = 151/215 (70.23%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN-QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F     LG GGFG+VY+GTLP   +++AVK++S  S QG KEF  E+V + +L+HRNLV+LLG+C  + E +LVY+++ N SLD +L++ + +  L+W  RY +I G+A G+LYLH++    +IHRD+KA N+LLD ++N ++ DFG+AR+++   T+  T  VVGT GY++PE++  G+ +  +DV+SFG  +LE+  GR+
Sbjct:  327 QFDFKVIEAATDKFSMCNKLGQGGFGQVYKGTLPNG-VQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEKILVYEFVSNKSLDYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMARIFEIDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGRK 540          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=2)

HSP 1 Score: 199.519 bits (506), Expect = 1.412e-50
Identity = 97/212 (45.75%), Postives = 147/212 (69.34%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            Y+ +  AT  F E   +G GGFG VY+GTL     E+AVK++S  S QG  EF  E+V + +L+HRNLV+LLG+C    E +LVY+Y+PN SLD +L++  K   L+W +RY +I GVA G+LYLH++    +IHRD+KASN+LLD ++N ++ DFG+AR++    T+  T+ +VGT GY++PE++  G+ +  +DV+SFG  +LE+  G++
Sbjct:  327 YRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGT-EVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKK 537          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: Y2296_ARATH (Probable receptor-like protein kinase At2g42960 OS=Arabidopsis thaliana GN=At2g42960 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.844e-50
Identity = 101/219 (46.12%), Postives = 139/219 (63.47%), Query Frame = 3
Query:    3 HRFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV--TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            H F  +DL +AT  F    +LG GG+G VYRG L     E+AVKK+ +   Q  KEF  E+ +IG +RH+NLV+LLGYC      +LVY+Y+ +G+L+++L+   +    L W  R  +I G A  L YLHE  E  V+HRD+KASN+L+D E N +L DFGLA+L D G    TT V+GT GY+APE++ TG     +D++SFG  LLE   GR P++
Sbjct:  169 HWFTLRDLELATNRFAPVNVLGEGGYGVVYRGKLVNGT-EVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCIEGVHRMLVYEYVNSGNLEQWLHGAMRQHGNLTWEARMKIITGTAQALAYLHEAIEPKVVHRDIKASNILIDDEFNAKLSDFGLAKLLDSGESHITTRVMGTFGYVAPEYANTGLLNEKSDIYSFGVLLLEAITGRDPVD 386          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CRK32_ARATH3.716e-5143.50Putative cysteine-rich receptor-like protein kinas... [more]
CRK20_ARATH3.716e-5146.05Putative cysteine-rich receptor-like protein kinas... [more]
CRK14_ARATH3.716e-5144.39Cysteine-rich receptor-like protein kinase 14 OS=A... [more]
CRK15_ARATH4.854e-5147.17Cysteine-rich receptor-like protein kinase 15 OS=A... [more]
CRK30_ARATH6.339e-5144.95Putative cysteine-rich receptor-like protein kinas... [more]
CRK19_ARATH6.339e-5145.58Cysteine-rich receptor-like protein kinase 19 OS=A... [more]
CRK40_ARATH1.081e-5046.05Cysteine-rich receptor-like protein kinase 40 OS=A... [more]
CRK5_ARATH1.412e-5044.65Cysteine-rich receptor-like protein kinase 5 OS=Ar... [more]
CRK10_ARATH1.412e-5045.75Cysteine-rich receptor-like protein kinase 10 OS=A... [more]
Y2296_ARATH1.844e-5046.12Probable receptor-like protein kinase At2g42960 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top