FC931420

Overview
NameFC931420
Unique NameFC931420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK16_ARATH (Putative cysteine-rich receptor-like protein kinase 16 OS=Arabidopsis thaliana GN=CRK16 PE=2 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 1.012e-48
Identity = 95/215 (44.19%), Postives = 146/215 (67.91%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYN-QPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +K +  AT  F++   LG GGFG V++GT P    E+AVK++S  S QG +EF  E++ + +L+HRNLV+LLG+     E +LVY+YMPN SLD +L++ + +  L+WR RY +I+GV  G+LYLH++    +IHRD+KA N+LLD ++N ++ DFG+AR +    T+  T  VVGT GY+ PE+   G+ +  +DV+SFG  +LE+  G++
Sbjct:  322 QFDFKAIEAATNNFQKSNKLGHGGFGEVFKGTFPNGT-EVAVKRLSKISGQGEEEFKNEVLLVAKLQHRNLVRLLGFSVEGEEKILVYEYMPNKSLDYFLFDHRRRGQLDWRTRYNIIRGVTRGILYLHQDSRLTIIHRDLKAGNILLDVDMNPKIADFGVARNFRVDQTEATTGRVVGTFGYMPPEYVANGQFSMKSDVYSFGVLILEIIVGKK 535          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK38_ARATH (Cysteine-rich receptor-like protein kinase 38 OS=Arabidopsis thaliana GN=CRK38 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.322e-48
Identity = 100/214 (46.73%), Postives = 145/214 (67.76%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            RF ++ +  AT  F  +  +G GGFG VY+G LP  + EIAVK+++  S QG  EF  E++ + RL+HRNLV+LLG+C    E +LVY+++PN SLD +++++ K + L W  R  +I+GVA GL+YLHE+ +  +IHRD+KASN+LLD  +N ++ DFG+ARL++   T   T  VVGT GY+APE+ R    +   DV+SFG  LLE+  GR
Sbjct:  326 RFDFRMILTATDDFSFENKIGQGGFGSVYKGKLPGGE-EIAVKRLTRGSGQGEIEFRNEVLLLTRLQHRNLVKLLGFCNEGDEEILVYEFVPNSSLDHFIFDEEKRLLLTWDMRARIIEGVARGLVYLHEDSQLRIIHRDLKASNILLDAYMNPKVADFGMARLFNMDQTRAVTRKVVGTFGYMAPEYVRNRTFSVKTDVYSFGVVLLEMITGR 538          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK25_ARATH (Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.322e-48
Identity = 92/215 (42.79%), Postives = 147/215 (68.37%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY-NQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F++  +  AT  F E   LG GGFG VY+G L   +  +A+K++S  S QG +EF  E+  + +L+HRNL +LLGYC    E +LVY+++PN SLD +L+ N+ +  L+W++RY +I+G+A G+LYLH +    +IHRD+KASN+LLD +++ ++ DFG+AR++    T   T  +VGT GY++PE++  GK +  +DV+SFG  +LE+  G++
Sbjct:  334 QFQFSAIEAATNKFSESNKLGHGGFGEVYKGQLITGET-VAIKRLSQGSTQGAEEFKNEVDVVAKLQHRNLAKLLGYCLDGEEKILVYEFVPNKSLDYFLFDNEKRRVLDWQRRYKIIEGIARGILYLHRDSRLTIIHRDLKASNILLDADMHPKISDFGMARIFGVDQTQANTKRIVGTYGYMSPEYAIHGKYSVKSDVYSFGVLVLELITGKK 547          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK21_ARATH (Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana GN=CRK21 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.726e-48
Identity = 95/215 (44.19%), Postives = 144/215 (66.98%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            RF ++ +  AT  F +   LG GGFG VY+G  P    E+A K++S  S QG  EF  E++ + RL+H+NLV LLG+     E +LVY+++PN SLD +L++  K V L+W +R+ +I+G+  G+LYLH++    +IHRD+KASN+LLD E+N ++ DFGLAR +  + T+  T  VVGT GY+ PE+   G+ +T +DV+SFG  +LE+  G++
Sbjct:  350 RFDFRAIKAATSNFHKSNKLGHGGFGAVYKGMFPNGT-EVAAKRLSKPSDQGEPEFKNEVLLVARLQHKNLVGLLGFSVEGEEKILVYEFVPNKSLDHFLFDPIKRVQLDWPRRHNIIEGITRGILYLHQDSRLTIIHRDLKASNILLDAEMNPKIADFGLARNFRVNQTEANTGRVVGTFGYMPPEYVANGQFSTKSDVYSFGVLILEIIGGKK 563          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK27_ARATH (Cysteine-rich receptor-like protein kinase 27 OS=Arabidopsis thaliana GN=CRK27 PE=2 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 2.945e-48
Identity = 98/214 (45.79%), Postives = 146/214 (68.22%), Query Frame = 3
Query:    9 FRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYD-HGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            F ++ + +AT  F     +G GGFG VY+G LP   +EIAVK++S  S QG  EF  E++ + +L+H+NLV+L G+  ++ E LLVY+++PN SLD++L++  K   L+W +RY +I GV+ GLLYLHE  E  +IHRD+K+SNVLLD ++  ++ DFG+AR +D   T   T  VVGT GY+APE++  G+ +   DV+SFG  +LE+  G+R
Sbjct:  321 FDFETIRVATDDFSLTNKIGEGGFGVVYKGHLPDG-LEIAVKRLSIHSGQGNAEFKTEVLLMTKLQHKNLVKLFGFSIKESERLLVYEFIPNTSLDRFLFDPIKQKQLDWEKRYNIIVGVSRGLLYLHEGSEFPIIHRDLKSSNVLLDEQMLPKISDFGMARQFDFDNTQAVTRRVVGTYGYMAPEYAMHGRFSVKTDVYSFGVLVLEIITGKR 533          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 191.43 bits (485), Expect = 3.846e-48
Identity = 97/215 (45.12%), Postives = 136/215 (63.26%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY--NQPKVTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRRPIE 653
            Y DL  +T  F +  ++G GGFG VY+ TLP  K ++A+KK+S +  Q  +EF AE+ ++ R +H NLV L G+C  K + LL+Y YM NGSLD +L+  N     L W+ R  + +G A GLLYLHE  +  ++HRD+K+SN+LLD   N  L DFGLARL        +T +VGTLGY+ PE+ +   AT   DV+SFG  LLE+   +RP++
Sbjct:  724 YDDLLDSTNSFDQANIIGCGGFGMVYKATLPDGK-KVAIKKLSGDCGQIEREFEAEVETLSRAQHPNLVLLRGFCFYKNDRLLIYSYMENGSLDYWLHERNDGPALLKWKTRLRIAQGAAKGLLYLHEGCDPHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVD 937          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK13_ARATH (Cysteine-rich receptor-like protein kinase 13 OS=Arabidopsis thaliana GN=CRK13 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.023e-48
Identity = 95/217 (43.78%), Postives = 147/217 (67.74%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQ---TTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            ++++K +  AT  F E+  LG GG G V++G LP  K EIAVK++S ++ Q  KEF  E+V + +L+HRNLV+LLG+  +  E ++VY+Y+PN SLD  L++  K   L+W++RY +I G A G+LYLH++ +  +IHRD+KA N+LLD  +N ++ DFG AR++  G D     T +  GT GY+APE+   G+ +  +DV+S+G  +LE+ CG+R
Sbjct:  347 QYKFKTIETATNNFSER--LGHGGSGHVFKGRLPDGK-EIAVKRLSEKTEQSKKEFKNEVVLVAKLQHRNLVRLLGFSVKGEEKIIVYEYLPNRSLDYILFDPTKQGELDWKKRYKIIGGTARGILYLHQDSQPTIIHRDLKAGNILLDAHMNPKVADFGTARIF--GMDQSVAITANAAGTPGYMAPEYMELGEFSMKSDVYSYGVLVLEIICGKR 558          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK28_ARATH (Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana GN=CRK28 PE=2 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 1.119e-47
Identity = 101/215 (46.98%), Postives = 143/215 (66.51%), Query Frame = 3
Query:   15 YKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPK-VTLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTH-----VVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGR 641
            ++ L  AT  F  +  LG GGFG VY+G     + EIAVK++S  S QG  EF  EI+ + +L+HRNLV+LLG+C    E +LVY+++ N SLD ++++  K   L+W  RY +I GVA GLLYLHE+    +IHRD+KASN+LLD E+N ++ DFGLA+LYD  TD  +TH     + GT GY+APE++  G+ +   DVFSFG  ++E+  G+
Sbjct:  351 FETLKAATDNFSPENELGRGGFGSVYKGVFSGGQ-EIAVKRLSCTSGQGDSEFKNEILLLAKLQHRNLVRLLGFCIEGQERILVYEFIKNASLDNFIFDLKKRQLLDWGVRYKMIGGVARGLLYLHEDSRYRIIHRDLKASNILLDQEMNPKIADFGLAKLYD--TDQTSTHRFTSKIAGTYGYMAPEYAIYGQFSVKTDVFSFGVLVIEIITGK 562          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK26_ARATH (Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana GN=CRK26 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.909e-47
Identity = 98/216 (45.37%), Postives = 143/216 (66.20%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKVT-LNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLY--DHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F +  L  AT  F  +  LG GGFG VY+G L   + +IAVK++S  ++QG  EF  E + + +L+HRNLV+LLGY     E LLVY+++P+ SLDK++++  +   L W  RY +I GVA GLLYLH++    +IHRD+KASN+LLD E+  ++ DFG+ARL+  DH T   T  +VGT GY+APE+   G+ +   DV+SFG  +LE+  G++
Sbjct:  331 KFDFSVLQDATSHFSLENKLGEGGFGAVYKGVLSDGQ-KIAVKRLSKNAQQGETEFKNEFLLVAKLQHRNLVKLLGYSIEGTERLLVYEFLPHTSLDKFIFDPIQGNELEWEIRYKIIGGVARGLLYLHQDSRLRIIHRDLKASNILLDEEMTPKIADFGMARLFDIDHTTQRYTNRIVGTFGYMAPEYVMHGQFSFKTDVYSFGVLVLEIISGKK 545          
BLAST of FC931420 vs. ExPASy Swiss-Prot
Match: CRK42_ARATH (Cysteine-rich receptor-like protein kinase 42 OS=Arabidopsis thaliana GN=CRK42 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.493e-47
Identity = 99/214 (46.26%), Postives = 139/214 (64.95%), Query Frame = 3
Query:    6 RFRYKDLYIATKGFREKELLGSGGFGRVYRGTLPKSKIEIAVKKISHESRQGMKEFVAEIVSIGRLRHRNLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYNQPKV-TLNWRQRYGVIKGVALGLLYLHEEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGTDPQTTHVVGTLGYLAPEHSRTGKATTSADVFSFGAFLLEVACGRR 644
            +F+Y+ L  AT  F  K++LG GG G V+ G LP  K  +AVK++   +R  ++EF  E+  I  ++H+NLV+LLG      E LLVY+Y+PN SLD++L+++ +   LNW QR  +I G A GL YLH      +IHRD+K SNVLLD +LN ++ DFGLAR +       +T + GTLGY+APE+   G+ T  ADV+SFG  +LE+ACG R
Sbjct:  302 KFKYETLEKATDYFSHKKMLGQGGNGTVFLGILPNGK-NVAVKRLVFNTRDWVEEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDQFLFDESQSKVLNWSQRLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDKTHLSTGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTR 514          
The following BLAST results are available for this feature:
BLAST of FC931420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CRK16_ARATH1.012e-4844.19Putative cysteine-rich receptor-like protein kinas... [more]
CRK38_ARATH1.322e-4846.73Cysteine-rich receptor-like protein kinase 38 OS=A... [more]
CRK25_ARATH1.322e-4842.79Cysteine-rich receptor-like protein kinase 25 OS=A... [more]
CRK21_ARATH1.726e-4844.19Cysteine-rich receptor-like protein kinase 21 OS=A... [more]
CRK27_ARATH2.945e-4845.79Cysteine-rich receptor-like protein kinase 27 OS=A... [more]
PSKR1_ARATH3.846e-4845.12Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
CRK13_ARATH5.023e-4843.78Cysteine-rich receptor-like protein kinase 13 OS=A... [more]
CRK28_ARATH1.119e-4746.98Cysteine-rich receptor-like protein kinase 28 OS=A... [more]
CRK26_ARATH1.909e-4745.37Cysteine-rich receptor-like protein kinase 26 OS=A... [more]
CRK42_ARATH2.493e-4746.26Cysteine-rich receptor-like protein kinase 42 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H09EF PostHarvP1 Citrus clementina cDNA clone C34104H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931420 ID=FC931420|Name=FC931420|organism=Citrus clementina|type=EST|length=700bp
CTCACAGGTTCAGGTACAAAGATCTTTACATTGCCACTAAAGGGTTCAGA
GAGAAAGAACTGCTAGGCAGCGGCGGATTTGGGAGAGTGTATAGGGGTAC
ACTGCCCAAATCCAAAATTGAGATTGCAGTGAAGAAGATTTCTCACGAAT
CCAGACAGGGGATGAAGGAATTCGTTGCGGAGATTGTGAGCATCGGTCGC
CTCAGGCACCGGAATTTAGTGCAACTCTTGGGATATTGCCGGCGTAAAGG
GGAGCTGCTTTTGGTCTATGATTACATGCCTAATGGAAGCTTAGACAAAT
ACCTCTATAACCAACCAAAAGTCACACTAAACTGGAGACAAAGATATGGA
GTCATCAAAGGTGTCGCATTAGGCCTGTTATATTTGCACGAAGAATGGGA
ACAAGTTGTGATTCACAGAGATGTTAAGGCAAGTAACGTGTTGCTTGATG
GTGAATTAAACGGAAGATTGGGAGATTTCGGCCTGGCAAGATTATACGAC
CACGGAACAGATCCACAAACAACGCACGTTGTGGGAACACTTGGGTACCT
TGCCCCTGAGCACAGTCGGACAGGCAAGGCCACCACAAGCGCTGATGTGT
TTTCATTTGGGGCATTTTTGCTTGAAGTTGCTTGCGGGAGAAGGCCAATT
GAGAGACAGAGCCAGAAGAGAATTTATTTTGGTTGATTGCGTGNTTGACT
back to top