FC931429

Overview
NameFC931429
Unique NameFC931429
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15323 contig Ccv1_Contig15323:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR6_ORYSJ (Pleiotropic drug resistance protein 6 OS=Oryza sativa subsp. japonica GN=PDR6 PE=2 SV=2)

HSP 1 Score: 214.927 bits (546), Expect = 3.343e-55
Identity = 103/236 (43.64%), Postives = 138/236 (58.47%), Query Frame = 2
Query:    8 GGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKM----DTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            G R +   D+FNAMG M+ AVLF+G+   +SVQP++S+ER V YRE+AAGMY+ +P+A + V +E PYILVQS++YG I Y++  FEWTA KF WY+               M  A+TPNH +A I++  FY LWN+F GF+            YYWANP++WTLYGL+ SQFGD+D   +     T  T   FL+D+F F+HD                       IK  NFQ+R
Sbjct: 1215 GSRRETQHDIFNAMGAMYAAVLFIGITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGTIFYSLGSFEWTAVKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTVAPIIAAPFYTLWNLFCGFMIPRKRIPAWWRWYYWANPVSWTLYGLLTSQFGDLDQPLLLADGITTTTAVDFLRDHFGFRHDFLGVVAGMVAGFCVLFAVVFALAIKYLNFQRR 1450          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB32G_ARATH (ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.728e-55
Identity = 104/237 (43.88%), Postives = 138/237 (58.23%), Query Frame = 2
Query:    8 GGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE-----TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            G +    Q LFNAMG M+ AVLF+G+   ++ QP+VS+ER V YRE+AAGMY+ +P+A AQV IE PY+L QS +Y  I YAM  FEW+A KF WY+               M  A+TPNH++A+I++  FY LWN+FSGF+            YYWANP+AWTLYGL+ SQ+GD D++ +   +      VKQ L+D   +KHD                       IK FNFQ+R
Sbjct: 1185 GSKRDTQQQLFNAMGSMYAAVLFIGITNATAAQPVVSIERFVSYRERAAGMYSALPFAFAQVFIEFPYVLAQSTIYSTIFYAMAAFEWSAVKFLWYLFFMYFSIMYFTFYGMMTTAITPNHNVASIIAAPFYMLWNLFSGFMIPYKRIPLWWRWYYWANPVAWTLYGLLVSQYGD-DERSVKLSDGIHQVMVKQLLEDVMGYKHDFLGVSAIMVVAFCVFFSLVFAFAIKAFNFQRR 1420          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB35G_ARATH (ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.189e-52
Identity = 99/237 (41.77%), Postives = 141/237 (59.49%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKM----DTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +GG+    QDL   +G ++ AV+F+G+  CS+VQP+V+VERTVFYREKAAGMY+ IP+A++QV  E+PY+L+Q+  Y  I+Y+M+GFEW A+KF W+I               M V+LTPN  +A+I ++ FYG++N+FSGF             YYW  P+AWT+YGL+ SQ+GD++          G TVKQ++KD + F+ D                       IK  NFQ R
Sbjct: 1206 IGGKRSNVQDLTMVIGAIYAAVVFVGINNCSTVQPMVAVERTVFYREKAAGMYSAIPYAISQVTCELPYVLIQTTYYSLIIYSMVGFEWKASKFLWFIFINYFSFLYWTYYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKWWVWYYWICPVAWTIYGLITSQYGDVETPIALLGGAPGLTVKQYIKDQYGFESDYMGPVAGVLVGFTVFFAFIFAFCIKTLNFQSR 1442          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB36G_ARATH (ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.460e-52
Identity = 96/237 (40.51%), Postives = 142/237 (59.92%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE----TVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +GG      DL   +G ++ A++F+G+  CS+VQP+V+VERTVFYRE+AAGMY+ +P+A++QV  E+PY+L+Q+V Y  IVYAM+GFEW A KFFW++               M V+LTPN  +A+I ++ FYG++N+FSGF             YYW  P+AWT+YGL+ SQ+GD++ +    G     TVKQ+++D++ F+ D                       I+  NFQ R
Sbjct: 1233 IGGNRSNAGDLTMVIGALYAAIIFVGINNCSTVQPMVAVERTVFYRERAAGMYSAMPYAISQVTCELPYVLIQTVYYSLIVYAMVGFEWKAEKFFWFVFVSYFSFLYWTYYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRPKIPKWWIWYYWICPVAWTVYGLIVSQYGDVETRIQVLGGAPDLTVKQYIEDHYGFQSDFMGPVAAVLIAFTVFFAFIFAFCIRTLNFQTR 1469          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR2_NICPL (Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.996e-51
Identity = 100/236 (42.37%), Postives = 136/236 (57.63%), Query Frame = 2
Query:    8 GGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGET----VKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            G +  R QDL N +G  + AV+FLG    S+VQ +V++ERTVFYRE+AAGMY+ +P+A AQV IE  Y+ +Q+ VY  ++++MIG++WTA KFF++                M VALTP + IAAIV + F   WN+FSGF+            YYWA+P+AWT+YG+ ASQ GD  D+   TGET    V +FLK+Y  + HD                       IK  N+QKR
Sbjct: 1226 GNQIHRQQDLLNLLGATYAAVMFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQVAIETIYVAIQTFVYSLLLFSMIGYQWTAVKFFYFYYFIFMCFTYFSMYGMMVVALTPGYQIAAIVMSFFLSFWNLFSGFLIPRPLIPVWWRWYYWASPVAWTIYGIFASQVGDRTDELELTGETEKIQVNEFLKEYLGYDHDFLLVVVFAHVGWVLLFFFVFAYGIKFLNYQKR 1461          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB31G_ARATH (ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.524e-50
Identity = 102/236 (43.22%), Postives = 138/236 (58.47%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDT--GETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            D+G +   +QDL   MG +++A LFLGV   SSVQPIVS+ERTVFYREKAAGMYA IP+A AQ ++EIPYIL Q+++YG I Y  IGFE T +KF  Y+               MAV LTPN H+AA++S+ FY LWN+ SGF+            +Y+  P+AWTL G++ SQ GD++    +     TVK+F++ YF +K +                       +K  NFQ+R
Sbjct: 1191 DIGSKRTSSQDLITVMGALYSACLFLGVSNASSVQPIVSIERTVFYREKAAGMYAPIPYAAAQGLVEIPYILTQTILYGVITYFTIGFERTFSKFVLYLVFMFLTFTYFTFYGMMAVGLTPNQHLAAVISSAFYSLWNLLSGFLVQKPLIPVWWIWFYYICPVAWTLQGVILSQLGDVESMINEPLFHGTVKEFIEYYFGYKPNMIGVSAAVLVGFCALFFSAFALSVKYLNFQRR 1426          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB29G_ARATH (ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.231e-49
Identity = 97/237 (40.93%), Postives = 139/237 (58.65%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDD----KKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +G + +   DL   +G M+ AVLF+GV   SSVQP+++VER+VFYRE+AA MY+ +P+ALAQV+ EIPY+L+Q+  Y  I+YAM+ FEWT AKFFW+                M VALTPN  +AA+ +  FYGL+N+FSGFV            YYW  P+AWT+YGL+ SQ+GD++D      M    T+K ++++++ +  D                       I+  NFQ+R
Sbjct: 1180 VGTKRENANDLTKVIGAMYAAVLFVGVNNSSSVQPLIAVERSVFYRERAAEMYSALPYALAQVVCEIPYVLIQTTYYTLIIYAMMCFEWTLAKFFWFYFVSFMSFLYFTYYGMMTVALTPNQQVAAVFAGAFYGLFNLFSGFVIPRPRIPKWWIWYYWICPVAWTVYGLIVSQYGDVEDTIKVPGMANDPTIKWYIENHYGYDADFMIPIATVLVGFTLFFAFMFAFGIRTLNFQQR 1416          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR15_ORYSJ (Pleiotropic drug resistance protein 15 OS=Oryza sativa subsp. japonica GN=PDR15 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.580e-49
Identity = 96/236 (40.68%), Postives = 141/236 (59.75%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGET---VKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +G + + ++DL   +G M+ AVLF+G +   +VQP+V+VERTVFYRE+AAGMY+ IP+ALAQV++EIPY+ V++V+Y  IVY M+ F+WT AKFFW+                M V+++PN  +A+I+   FY L+N+FSGF             YYW  P+AWT+YGL+ SQ+GD++D     G++   V+ F+KDYF +  D                       I+  NFQ+R
Sbjct: 1274 VGHKMESSKDLLVIIGSMYAAVLFVGFENSVTVQPVVAVERTVFYRERAAGMYSAIPYALAQVVVEIPYVFVETVIYTLIVYPMMSFQWTPAKFFWFFYVSFFTFLYFTYYGMMNVSVSPNLQVASILGAAFYTLFNLFSGFFIPRPKIPKWWVWYYWLCPVAWTVYGLIVSQYGDVEDFITVPGQSDQQVRPFIKDYFGYDPDFMGVVAAVLAGFTVFFAFTYAYSIRTLNFQQR 1509          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB39G_ARATH (ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.580e-49
Identity = 101/236 (42.80%), Postives = 132/236 (55.93%), Query Frame = 2
Query:    5 LGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTG---ETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +G +T+  QDL N  G M+ AVLFLG    ++VQP +++ERTVFYREKAAGMY+ IP+A++QV +EI Y  +Q+ VY  I+Y+MIG  WT AKF W+                M +ALTPN+ IA I  + F  LWN+FSGF+            YYWA P+AWTLYGL+ SQ GD D     +G     +K  LK+ F F+HD                       IK  NFQ+R
Sbjct: 1219 IGTKTENEQDLNNFFGAMYAAVLFLGALNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQVAVEIMYNTIQTGVYTLILYSMIGCNWTMAKFLWFYYYMLTSFIYFTLYGMMLMALTPNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGLITSQVGDKDSMVHISGIGDIDLKTLLKEGFGFEHDFLPVVAVVHIAWILLFLFVFAYGIKFLNFQRR 1454          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB34G_ARATH (ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.676e-49
Identity = 100/235 (42.55%), Postives = 133/235 (56.60%), Query Frame = 2
Query:    8 GGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTG---ETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            G + ++ QDL N  G M+ AVLFLG    ++VQP V++ERTVFYREKAAGMY+ IP+A++QV +EI Y  +Q+ VY  I+Y+MIG++WT  KFFW+                M VALTPN+ IA I  + F   WN+FSGF+            YYWA+P+AWTLYG++ SQ GD D     TG    ++K  LK+ F F +D                       IK  NFQ+R
Sbjct: 1219 GTKIEKEQDLNNFFGAMYAAVLFLGATNAATVQPAVAIERTVFYREKAAGMYSAIPYAISQVAVEIMYNTIQTGVYTLILYSMIGYDWTVVKFFWFYYYMLTCFVYFTLYGMMLVALTPNYQIAGICLSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGIITSQVGDRDSIVHITGVGDMSLKTLLKNGFGFDYDFLPVVAVVHIAWILIFLFAFAYGIKFLNFQRR 1453          
The following BLAST results are available for this feature:
BLAST of FC931429 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
PDR6_ORYSJ3.343e-5543.64Pleiotropic drug resistance protein 6 OS=Oryza sat... [more]
AB32G_ARATH9.728e-5543.88ABC transporter G family member 32 OS=Arabidopsis ... [more]
AB35G_ARATH1.189e-5241.77ABC transporter G family member 35 OS=Arabidopsis ... [more]
AB36G_ARATH3.460e-5240.51ABC transporter G family member 36 OS=Arabidopsis ... [more]
PDR2_NICPL4.996e-5142.37Pleiotropic drug resistance protein 2 OS=Nicotiana... [more]
AB31G_ARATH5.524e-5043.22ABC transporter G family member 31 OS=Arabidopsis ... [more]
AB29G_ARATH1.231e-4940.93ABC transporter G family member 29 OS=Arabidopsis ... [more]
PDR15_ORYSJ3.580e-4940.68Pleiotropic drug resistance protein 15 OS=Oryza sa... [more]
AB39G_ARATH3.580e-4942.80ABC transporter G family member 39 OS=Arabidopsis ... [more]
AB34G_ARATH4.676e-4942.55ABC transporter G family member 34 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A06EF PostHarvP1 Citrus clementina cDNA clone C34105A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931429 ID=FC931429|Name=FC931429|organism=Citrus clementina|type=EST|length=713bp
GGACCTGGGTGGTAGAACGAAAAGGAACCAAGATCTTTTCAATGCAATGG
GTCCCATGTTTACTGCAGTTCTCTTCCTTGGTGTTCAATATTGTTCGTCA
GTGCAGCCAATAGTATCAGTTGAAAGGACAGTCTTTTACAGGGAAAAAGC
TGCCGGCATGTATGCAGGCATACCATGGGCATTAGCACAAGTTATGATTG
AGATTCCTTATATATTAGTTCAGTCAGTAGTGTATGGTGCTATAGTCTAT
GCTATGATTGGATTTGAATGGACAGCCGCCAAGTTTTTTTGGTATATATT
CTTCATGTACTTCACATTATTGTTCTTCACCTTCTATGGCATGATGGCTG
TGGCTTTGACACCAAACCACCACATCGCTGCCATTGTTTCAACTTTATTT
TATGGATTGTGGAACGTCTTTTCTGGGTTTGTTATCCCAAGACCTAGGAT
TCCAATATGGTGGAGATGGTACTATTGGGCCAACCCCATAGCTTGGACCT
TGTATGGACTGGTTGCTTCGCAGTTCGGAGATATGGACGACAAGAAAATG
GATACTGGTGAAACGGTGAAACAGTTTCTTAAGGACTATTTTGATTTCAA
ACATGATTTTCTGGGAGTAGTTGCAGCTGTTCTCGTTGTCTTTGCAGTGT
TATTTGGATTTCTCTTCGCCCTAGGAATTAAGATGTTTAACTTCCAGAAG
CGGTAGTAATTCT
back to top