FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSKP_CAPAN (Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.163e-53
Identity = 103/129 (79.84%), Postives = 120/129 (93.02%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+DVT+LIG TP+VYLN IV GCVA IAAKLE+MEPC SVKDRIG+SMI+DAEEKGLI PG++VL+EPTSGNTGIGLAF+AA++GY+LI+TMPASMSLERR++L AFGAELVLTDPA+GMK AV KAE
Sbjct:   67 IAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKGMKGAVSKAE 195          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSKP_SOLTU (Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.420e-53
Identity = 102/129 (79.07%), Postives = 118/129 (91.47%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+DVT+LIG TP+VYLN I  GCVA IAAKLE+MEPC SVKDRIG+SMI DAEEKGLI PG++VL+EPTSGNTGIGLAF+AA++GY+LI+TMPASMSLERR++L AFGAELVLTDPA+GMK AV KAE
Sbjct:   69 IAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKGMKGAVSKAE 197          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSKM_ARATH (Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3)

HSP 1 Score: 204.142 bits (518), Expect = 4.887e-52
Identity = 100/129 (77.52%), Postives = 117/129 (90.70%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA +V++LIGKTP+VYLN I  GCVA IAAKLE+MEPC SVKDRIGYSM+ DAE+KG I PG+SVL+EPTSGNTGIGLAF+AA++GYRLI+TMPASMS+ERR++L AFGAELVLTDPA+GM  AVQKAE
Sbjct:  113 IADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKAE 241          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSKP_ARATH (Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2)

HSP 1 Score: 201.83 bits (512), Expect = 2.425e-51
Identity = 99/129 (76.74%), Postives = 116/129 (89.92%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA +  +LIGKTP+VYLN +V GCVA +AAKLE+MEPC SVKDRIGYSMI DAEEKGLI PG+SVL+E TSGNTGIGLAF+AA+KGY+LI+TMPASMSLERR++L AFGAELVLT+PA+GM  A+QKAE
Sbjct:   75 IADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAKGMTGAIQKAE 203          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSKP_SPIOL (Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 3.502e-50
Identity = 96/129 (74.42%), Postives = 116/129 (89.92%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+DV++LIGKTP+VYLN +  G VA IAAKLE MEPC SVKDRIGYSMI DAE+KG+I PG++ L+EPTSGNTGIGLAF+AAA+GY++ +TMPASMS+ERR++L AFGAELVLTDPA+GMK AV+KAE
Sbjct:   67 IAEDVSQLIGKTPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTSGNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAELVLTDPAKGMKGAVEKAE 195          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK4_ARATH (Probable cysteine synthase, chloroplastic OS=Arabidopsis thaliana GN=At3g03630 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.007e-46
Identity = 88/129 (68.22%), Postives = 112/129 (86.82%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+DVT+LIG TP+VYLNR+ DGC+A IAAKLE MEPC SVKDRIG SMI +AE  G I P ++VL+EPT+GNTG+G+AF+AAAKGY+LI+TMPAS+++ERRM+L A GAE+VLT+P +G+K AV KA+
Sbjct:   99 IAEDVTQLIGSTPMVYLNRVTDGCLADIAAKLESMEPCRSVKDRIGLSMINEAENSGAITPRKTVLVEPTTGNTGLGIAFVAAAKGYKLIVTMPASINIERRMLLRALGAEIVLTNPEKGLKGAVDKAK 227          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_MYCTU (Cysteine synthase A OS=Mycobacterium tuberculosis GN=cysK PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 78/129 (60.47%), Postives = 102/129 (79.07%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+D+T+LIG+TPLV L R+ DG VA I AKLE   P +SVKDRIG +M+  AE+ GLI+P +++++EPTSGNTGI LA + AA+GYR ++TMP +MSLERRM+L A+GAEL+LT  A GM  A+ KAE
Sbjct:    3 IAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGLIKP-DTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGADGMSGAIAKAE 130          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_MYCBO (Cysteine synthase A OS=Mycobacterium bovis GN=cysK PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 78/129 (60.47%), Postives = 102/129 (79.07%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+D+T+LIG+TPLV L R+ DG VA I AKLE   P +SVKDRIG +M+  AE+ GLI+P +++++EPTSGNTGI LA + AA+GYR ++TMP +MSLERRM+L A+GAEL+LT  A GM  A+ KAE
Sbjct:    3 IAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGLIKP-DTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGADGMSGAIAKAE 130          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_SYNY3 (Cysteine synthase OS=Synechocystis sp. (strain PCC 6803) GN=cysK PE=3 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 1.292e-36
Identity = 79/131 (60.31%), Postives = 104/131 (79.39%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRI--VDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA ++TELIG+TPLV LNRI  ++GC A+I  KLE M P +SVKDRIG +MI  AE++GLI PG+++LIEPTSGNTGI LA +AAAKGY+LI+TMP +MS ERR +L A+GA+L LT  + GM   +++A+
Sbjct:    3 IASNITELIGRTPLVRLNRIPLLEGCGAKIVVKLEGMNPAASVKDRIGINMINRAEQEGLIEPGKTLLIEPTSGNTGIALAMVAAAKGYQLILTMPETMSQERRAMLKAYGAKLELTPGSEGMGGCIRRAQ 133          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_MYCLE (Cysteine synthase A OS=Mycobacterium leprae GN=cysK PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.687e-36
Identity = 76/129 (58.91%), Postives = 100/129 (77.52%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA+DVT+L+G TPLV L R+ +G +A + AKLE   P +SVKDRIG +MI  AEE GLI+P ++V++EPTSGNTGI LA + AA+GY  ++TMP +MS+ERRM+L A+GAEL+LT  A GM  A+ KAE
Sbjct:    3 IAEDVTQLVGNTPLVRLRRVTEGALADVVAKLESFNPANSVKDRIGVAMIDTAEEAGLIKP-DTVILEPTSGNTGIALAMVCAARGYHCVLTMPETMSIERRMLLRAYGAELILTPGADGMSGAIAKAE 130          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CYSKP_CAPAN1.163e-5379.84Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSKP_SOLTU4.420e-5379.07Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSKM_ARATH4.887e-5277.52Cysteine synthase, mitochondrial OS=Arabidopsis th... [more]
CYSKP_ARATH2.425e-5176.74Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSKP_SPIOL3.502e-5074.42Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSK4_ARATH4.007e-4668.22Probable cysteine synthase, chloroplastic OS=Arabi... [more]
CYSK_MYCTU6.851e-3860.47Cysteine synthase A OS=Mycobacterium tuberculosis ... [more]
CYSK_MYCBO6.851e-3860.47Cysteine synthase A OS=Mycobacterium bovis GN=cysK... [more]
CYSK_SYNY31.292e-3660.31Cysteine synthase OS=Synechocystis sp. (strain PCC... [more]
CYSK_MYCLE1.687e-3658.91Cysteine synthase A OS=Mycobacterium leprae GN=cys... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top