FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STRP6 (Cysteine synthase OS=Streptococcus pyogenes serotype M6 GN=cysK PE=1 SV=3)

HSP 1 Score: 149.443 bits (376), Expect = 1.428e-35
Identity = 78/129 (60.47%), Postives = 97/129 (75.19%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            I K +TEL+G+TP++ LNR++    A +  KLE   P SSVKDRI  SMI  AE +GLI PG+ V+IEPTSGNTGIGLA++ AAKGYR+II MP +MSLERR ++ A+GAELVLT  A GMK A+ K E
Sbjct:    4 IYKTITELVGQTPIIKLNRLIPNEAADVYVKLEAFNPGSSVKDRIALSMIEAAEAEGLISPGD-VIIEPTSGNTGIGLAWVGAAKGYRVIIVMPETMSLERRQIIQAYGAELVLTPGAEGMKGAIAKTE 131          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_BACSU (Cysteine synthase OS=Bacillus subtilis GN=cysK PE=1 SV=3)

HSP 1 Score: 143.28 bits (360), Expect = 1.024e-33
Identity = 76/129 (58.91%), Postives = 97/129 (75.19%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            +A  +TELIG TP+V LNR+ D   A +  KLE M P SSVKDRIG +MI  AE++G ++ G ++ IEPTSGNTGIGLA +AAAKG + I+ MP +MS+ERR +L A+GAELVLT  A GMK A++KAE
Sbjct:    4 VANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGKLKAGNTI-IEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAEGMKGAIKKAE 131          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_NEIMB (Cysteine synthase OS=Neisseria meningitidis serogroup B GN=cysK PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.978e-33
Identity = 75/129 (58.14%), Postives = 93/129 (72.09%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA  +TELIG TPLV LNR+ +G  A +A KLE   P SSVKDRI  +MI  AE+ G I    +V++E TSGNTG+GLA + AA+GY+L ITMP SMS ER+M+L AFGAEL+LT  A GM  A+ KA+
Sbjct:    3 IANSITELIGNTPLVKLNRLTEGLKAEVAVKLEFFNPGSSVKDRIAEAMIEGAEKAGKINKN-TVIVEATSGNTGVGLAMVCAARGYKLAITMPESMSKERKMLLRAFGAELILTPAAEGMAGAIAKAK 130          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: SRPG_SYNE7 (Cysteine synthase, plasmid OS=Synechococcus elongatus (strain PCC 7942) GN=srpG PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.635e-33
Identity = 76/126 (60.32%), Postives = 96/126 (76.19%), Query Frame = 2
Query:  263 DVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            D ++ IGKTPLV LNRIV G  A + AK+E   P  SVK RIG +MI DAE++GL+ PG+  LIEPTSGNTGI LAF+AAA+G  L +TMP +MSLERR +L A+GA+LVLT+  +GM  AV++AE
Sbjct:   10 DNSQTIGKTPLVRLNRIVKGAPATVLAKIEGRNPAYSVKCRIGAAMIWDAEQRGLLGPGKE-LIEPTSGNTGIALAFVAAARGIPLTLTMPETMSLERRKLLAAYGAKLVLTEGVKGMTGAVRRAE 134          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_SALTY (Cysteine synthase A OS=Salmonella typhimurium GN=cysK PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.293e-32
Identity = 77/131 (58.78%), Postives = 99/131 (75.57%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S I +D +  IG TPLV LNRI +G   RI AK+E   P  SVK RIG +MI DAE++G+++PG   L+EPTSGNTGI LA++AAA+GY+L +TMP +MS+ERR +L A GA LVLT+ A+GMK A+QKAE
Sbjct:    2 SKIYEDNSLTIGHTPLVRLNRIGNG---RILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVE-LVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAE 128          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_SALTI (Cysteine synthase A OS=Salmonella typhi GN=cysK PE=3 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.293e-32
Identity = 77/131 (58.78%), Postives = 99/131 (75.57%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S I +D +  IG TPLV LNRI +G   RI AK+E   P  SVK RIG +MI DAE++G+++PG   L+EPTSGNTGI LA++AAA+GY+L +TMP +MS+ERR +L A GA LVLT+ A+GMK A+QKAE
Sbjct:    2 SKIYEDNSLTIGHTPLVRLNRIGNG---RILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVE-LVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAE 128          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_ECOLI (Cysteine synthase A OS=Escherichia coli (strain K12) GN=cysK PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.293e-32
Identity = 77/131 (58.78%), Postives = 99/131 (75.57%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S I +D +  IG TPLV LNRI +G   RI AK+E   P  SVK RIG +MI DAE++G+++PG   L+EPTSGNTGI LA++AAA+GY+L +TMP +MS+ERR +L A GA LVLT+ A+GMK A+QKAE
Sbjct:    2 SKIFEDNSLTIGHTPLVRLNRIGNG---RILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVE-LVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAE 128          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_ECO57 (Cysteine synthase A OS=Escherichia coli O157:H7 GN=cysK PE=3 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.293e-32
Identity = 77/131 (58.78%), Postives = 99/131 (75.57%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S I +D +  IG TPLV LNRI +G   RI AK+E   P  SVK RIG +MI DAE++G+++PG   L+EPTSGNTGI LA++AAA+GY+L +TMP +MS+ERR +L A GA LVLT+ A+GMK A+QKAE
Sbjct:    2 SKIFEDNSLTIGHTPLVRLNRIGNG---RILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVE-LVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAE 128          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAES (Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.788e-31
Identity = 70/125 (56.00%), Postives = 91/125 (72.80%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            VT++IG TP+V L  +VD   A I  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    9 VTQIIGNTPVVKLRNVVDDDAADIYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_STAEQ (Cysteine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.788e-31
Identity = 70/125 (56.00%), Postives = 91/125 (72.80%), Query Frame = 2
Query:  266 VTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            VT++IG TP+V L  +VD   A I  KLE   P  SVKDRI  +MI  AE +G I+PG+++ +EPTSGNTGIGLAF+ AAKGY+ + TMP +MS ERR +L A+GAELVLT  +  MK A++KA+
Sbjct:    9 VTQIIGNTPVVKLRNVVDDDAADIYVKLEYQNPGGSVKDRIALAMIEKAEREGKIKPGDTI-VEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPGSEAMKGAIKKAK 132          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CYSK_STRP61.428e-3560.47Cysteine synthase OS=Streptococcus pyogenes seroty... [more]
CYSK_BACSU1.024e-3358.91Cysteine synthase OS=Bacillus subtilis GN=cysK PE=... [more]
CYSK_NEIMB2.978e-3358.14Cysteine synthase OS=Neisseria meningitidis serogr... [more]
SRPG_SYNE76.635e-3360.32Cysteine synthase, plasmid OS=Synechococcus elonga... [more]
CYSK_SALTY3.293e-3258.78Cysteine synthase A OS=Salmonella typhimurium GN=c... [more]
CYSK_SALTI3.293e-3258.78Cysteine synthase A OS=Salmonella typhi GN=cysK PE... [more]
CYSK_ECOLI3.293e-3258.78Cysteine synthase A OS=Escherichia coli (strain K1... [more]
CYSK_ECO573.293e-3258.78Cysteine synthase A OS=Escherichia coli O157:H7 GN... [more]
CYSK_STAES2.788e-3156.00Cysteine synthase OS=Staphylococcus epidermidis (s... [more]
CYSK_STAEQ2.788e-3156.00Cysteine synthase OS=Staphylococcus epidermidis (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top