FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_DICDI (Cystathionine beta-synthase OS=Dictyostelium discoideum GN=cysB PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.301e-24
Identity = 60/116 (51.72%), Postives = 78/116 (67.24%), Query Frame = 2
Query:  251 VIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLT 598
            +I  ++ + IG TPLV +N++       + AK E      SVKDRIG+ MI DAEE G I+ G++ LIEPTSGNTGIGLA  AA KGY++IIT+P  MS E+  VL A GAE++ T
Sbjct:   31 LIMDNILDNIGGTPLVRVNKVSSDLECELVAKCEFFNAGGSVKDRIGHRMIVDAEESGRIKKGDT-LIEPTSGNTGIGLALTAAIKGYKMIITLPEKMSQEKVDVLKALGAEIIRT 145          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_BUCAP (Cysteine synthase OS=Buchnera aphidicola subsp. Schizaphis graminum GN=cysK PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 4.311e-24
Identity = 66/128 (51.56%), Postives = 84/128 (65.62%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKA 637
            I +D +  IG TPLV LN I +G    I AK+E   P  SVK RIG +MI DAE+KG +     + IE TSGNTGI LA++AAA+ Y L + MP SMS+ERR +L + GA L+LT+   GMK A+ KA
Sbjct:    4 IYEDNSFTIGNTPLVRLNNIGNG---NILAKIESRNPSFSVKCRIGANMIWDAEKKGRLNKNIEI-IEATSGNTGIALAYVAAARNYSLTLIMPDSMSIERRKLLKSLGAHLILTNGKHGMKGAISKA 127          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_SALTY (Cysteine synthase B OS=Salmonella typhimurium GN=cysM PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.630e-24
Identity = 62/118 (52.54%), Postives = 79/118 (66.95%), Query Frame = 2
Query:  272 ELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRA 625
            + IG TPLV L R+     + I  KLE   P  SVKDR   SMI +AE++G I+PG+ VLIE TSGNTGI LA +AA KGYR+ + MP +MS ERR  + A+GAEL+L    +GM+ A
Sbjct:    6 QTIGNTPLVKLQRLGPDNGSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGD-VLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGA 122          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_RABIT (Cystathionine beta-synthase OS=Oryctolagus cuniculus GN=CBS PE=2 SV=3)

HSP 1 Score: 110.153 bits (274), Expect = 9.604e-24
Identity = 63/117 (53.85%), Postives = 75/117 (64.10%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVD--GCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLT 598
            I  D+ + IG TP+V +N+I    G    + AK E      SVKDRI   MI DAE  G +RPG+++ IEPTSGNTGIGLA  AA KGYR II MP  MSLE+  VL A GAE+V T
Sbjct:   76 ILPDILQKIGDTPMVRINKIGKNFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLRPGDTI-IEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSLEKVDVLRALGAEIVRT 191          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSM_ECOLI (Cysteine synthase B OS=Escherichia coli (strain K12) GN=cysM PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.254e-23
Identity = 61/118 (51.69%), Postives = 79/118 (66.95%), Query Frame = 2
Query:  272 ELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRA 625
            + IG TPLV L R+     + +  KLE   P  SVKDR   SMI +AE++G I+PG+ VLIE TSGNTGI LA +AA KGYR+ + MP +MS ERR  + A+GAEL+L    +GM+ A
Sbjct:    6 QTIGNTPLVKLQRMGPDNGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGD-VLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGA 122          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_RAT (Cystathionine beta-synthase OS=Rattus norvegicus GN=Cbs PE=1 SV=3)

HSP 1 Score: 109.383 bits (272), Expect = 1.638e-23
Identity = 62/117 (52.99%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVD--GCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLT 598
            I  D+   IG TP+V +NRI    G    + AK E      SVKDRI   MI DAE  G ++PG+++ IEPTSGNTGIGLA  AA KGYR II MP  MS+E+  VL A GAE+V T
Sbjct:   73 ILPDILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPGDTI-IEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRT 188          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_HAEIN (Cysteine synthase OS=Haemophilus influenzae GN=cysK PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.766e-23
Identity = 60/129 (46.51%), Postives = 83/129 (64.34%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            I  D +  IG TPLV L     G    +  K+E   P  SVK RIG +M+  AE+ G +  G+ + ++ TSGNTGI LA++AAA+GY++ +TMP +MSLER+ +L   G  LVLT+ A+GMK A+ KAE
Sbjct:    3 IYADNSYSIGNTPLVRLKHF--GHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEI-VDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAE 128          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_MOUSE (Cystathionine beta-synthase OS=Mus musculus GN=Cbs PE=2 SV=3)

HSP 1 Score: 107.457 bits (267), Expect = 6.225e-23
Identity = 61/117 (52.14%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVD--GCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLT 598
            I  D+   IG TP+V +N+I    G    + AK E      SVKDRI   MI DAE  G ++PG+++ IEPTSGNTGIGLA  AA KGYR II MP  MS+E+  VL A GAE+V T
Sbjct:   73 ILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTI-IEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRT 188          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_HUMAN (Cystathionine beta-synthase OS=Homo sapiens GN=CBS PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.089e-22
Identity = 60/117 (51.28%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVD--GCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLT 598
            I  D+ + IG TP+V +N+I    G    + AK E      SVKDRI   MI DAE  G ++PG+++ IEPTSGNTGIGLA  AA +GYR II MP  MS E+  VL A GAE+V T
Sbjct:   76 ILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTI-IEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRT 191          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CBS_MACFA (Cystathionine beta-synthase OS=Macaca fascicularis GN=CBS PE=2 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 4.035e-22
Identity = 59/117 (50.43%), Postives = 74/117 (63.25%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVD--GCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLT 598
            I  D+ + IG TP++ +N+I    G    + AK E      SVKDRI   MI DAE  G ++PG+++ IEPTSGNTGIGLA  AA +GYR II MP  MS E+  VL A GAE+V T
Sbjct:   76 ILPDILKKIGDTPMIRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPGDTI-IEPTSGNTGIGLALTAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRT 191          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CBS_DICDI3.301e-2451.72Cystathionine beta-synthase OS=Dictyostelium disco... [more]
CYSK_BUCAP4.311e-2451.56Cysteine synthase OS=Buchnera aphidicola subsp. Sc... [more]
CYSM_SALTY5.630e-2452.54Cysteine synthase B OS=Salmonella typhimurium GN=c... [more]
CBS_RABIT9.604e-2453.85Cystathionine beta-synthase OS=Oryctolagus cunicul... [more]
CYSM_ECOLI1.254e-2351.69Cysteine synthase B OS=Escherichia coli (strain K1... [more]
CBS_RAT1.638e-2352.99Cystathionine beta-synthase OS=Rattus norvegicus G... [more]
CYSK_HAEIN4.766e-2346.51Cysteine synthase OS=Haemophilus influenzae GN=cys... [more]
CBS_MOUSE6.225e-2352.14Cystathionine beta-synthase OS=Mus musculus GN=Cbs... [more]
CBS_HUMAN3.089e-2251.28Cystathionine beta-synthase OS=Homo sapiens GN=CBS... [more]
CBS_MACFA4.035e-2250.43Cystathionine beta-synthase OS=Macaca fascicularis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top