BQ622923

Overview
NameBQ622923
Unique NameBQ622923
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length472
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8638 contig Csv1_Contig8638:593..1062. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT1_MOUSE (Alanine aminotransferase 1 OS=Mus musculus GN=Gpt PE=2 SV=3)

HSP 1 Score: 51.6026 bits (122), Expect = 1.992e-14
Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG +H R TILP  E +  ++E  + F+ +F  +Y
Sbjct:  451 VVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 495          

HSP 2 Score: 47.3654 bits (111), Expect = 1.992e-14
Identity = 21/35 (60.00%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFPQI+LP KA++ A+  G  PD+F+CL LLE T
Sbjct:  413 YSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEET 447          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT1_RAT (Alanine aminotransferase 1 OS=Rattus norvegicus GN=Gpt PE=1 SV=2)

HSP 1 Score: 50.447 bits (119), Expect = 3.361e-14
Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG +H R TILP  E +  ++E    F+ +F  +Y
Sbjct:  451 VVPGSGFGQQEGTYHFRMTILPPMEKLRLLLEKLSHFHAKFTHEY 495          

HSP 2 Score: 47.7506 bits (112), Expect = 3.361e-14
Identity = 20/35 (57.14%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFPQ++LP KA++ A+  G  PD+F+CL LLE T
Sbjct:  413 YSFPQVQLPLKAVQRAQELGLAPDMFFCLCLLEET 447          
The following BLAST results are available for this feature:
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ALAT1_MOUSE1.992e-1446.67Alanine aminotransferase 1 OS=Mus musculus GN=Gpt ... [more]
ALAT1_RAT3.361e-1446.67Alanine aminotransferase 1 OS=Rattus norvegicus GN... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00014 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00014 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622923 ID=BQ622923|Name=BQ622923|organism=Citrus sinensis|type=EST|length=472bp
TGTATTCATTCCCTCAAATACGCCTACCTCCAAAAGCAATAGAGGCTGCT
AAGAGGGCGGGAAAAGTTCCTGATGTTTTCTACTGTCTCCGGCTTTTGGA
AGCCACTAGGCATTTCTACTAGTCCCTGGTTCTGGATTTGGACAGAAAGA
AGGGATCTTCCATTTAAGGACAACAATTTTACCGGCTGAGGAAGACATGC
CAGCAATCATGGAGAGTTTCAAGAAGTTCAATGATGAGTTCATGGAGCAA
TATGAAGACTACAGGGGCTATTCAAGAATGTAAGGGACGTCCAAATTCCC
AAAATTTGTATTATATTATTCAAAGGCTATAGAAAGCCATCGATATATGC
TCCCTACTTTCGTCCTAACCCCTTTTTAGTAGGAAAAACTTCAGTCGGTT
GAAGATTGCCCATATTATCTCTGTTTGACTCCTGTTTCATCCCTTATAAA
TATTCTCTATGAATTATGAACA
back to top