BQ622923
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT1_MOUSE (Alanine aminotransferase 1 OS=Mus musculus GN=Gpt PE=2 SV=3) HSP 1 Score: 51.6026 bits (122), Expect = 1.992e-14 Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 2 Query: 119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253 +VPGSGFGQ+EG +H R TILP E + ++E + F+ +F +Y Sbjct: 451 VVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 495 HSP 2 Score: 47.3654 bits (111), Expect = 1.992e-14 Identity = 21/35 (60.00%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107 YSFPQI+LP KA++ A+ G PD+F+CL LLE T Sbjct: 413 YSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEET 447
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT1_RAT (Alanine aminotransferase 1 OS=Rattus norvegicus GN=Gpt PE=1 SV=2) HSP 1 Score: 50.447 bits (119), Expect = 3.361e-14 Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 2 Query: 119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253 +VPGSGFGQ+EG +H R TILP E + ++E F+ +F +Y Sbjct: 451 VVPGSGFGQQEGTYHFRMTILPPMEKLRLLLEKLSHFHAKFTHEY 495 HSP 2 Score: 47.7506 bits (112), Expect = 3.361e-14 Identity = 20/35 (57.14%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107 YSFPQ++LP KA++ A+ G PD+F+CL LLE T Sbjct: 413 YSFPQVQLPLKAVQRAQELGLAPDMFFCLCLLEET 447 The following BLAST results are available for this feature:
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ622923 ID=BQ622923; Name=BQ622923; organism=Citrus sinensis; type=EST; length=472bpback to top |