BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_GLOVI (30S ribosomal protein S9 OS=Gloeobacter violaceus GN=rpsI PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.228e-32
Identity = 73/129 (56.59%), Postives = 89/129 (68.99%), Query Frame = 2
Query:   95 AQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            A   +GTGRRKCAIARV L  G+G+ +IN R   EYL      +   K PL TLG E  Y++ V A GGG++GQA AI LG+ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:    5 AAVYWGTGRRKCAIARVRLVPGSGELVINGRPGDEYLHFRQPLMSLAKAPLETLGLENQYNIIVNASGGGVAGQAGAIRLGIARALCELSPDNRRPLKVEGYLSRDPRAKERRKYGLKKARKAPQFSKR 133          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_PROMS (30S ribosomal protein S9 OS=Prochlorococcus marinus (strain AS9601) GN=rpsI PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.603e-32
Identity = 74/125 (59.20%), Postives = 86/125 (68.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G   IN R   +YL  NPL L  IK PL TLG E SYD+ V   GGGL+GQA AI  G ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:   12 WGTGRRKTSVARVRLIPGNGLIKINGRSGDDYLNFNPLHLNSIKAPLQTLGLENSYDILVNVFGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_PROM5 (30S ribosomal protein S9 OS=Prochlorococcus marinus (strain MIT 9515) GN=rpsI PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.603e-32
Identity = 73/125 (58.40%), Postives = 86/125 (68.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G+  IN R   +YL  NP  L  +K PL TLG E SYD+FV   GGGL+GQA AI  G ARAL  +S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:   12 WGTGRRKTSVARVRLIPGNGQIKINGRSGDDYLNFNPSHLNSVKAPLQTLGLENSYDIFVNVFGGGLTGQADAIKQGAARALCDLSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_PROMM (30S ribosomal protein S9 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsI PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-32
Identity = 72/125 (57.60%), Postives = 85/125 (68.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G+G   IN R    YL  NP +L  +K PL TLG    YDV V  HGGGL+GQA AI  G ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:   11 WGTGRRKTSVARVRLVPGSGTITINGRPGDHYLNFNPAYLAAVKAPLQTLGLNEQYDVLVNVHGGGLTGQADAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_PROM0 (30S ribosomal protein S9 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsI PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-32
Identity = 74/125 (59.20%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G   IN R   +YL  NPL L  IK PL TLG E SYD++V   GGGL+GQA AI  G ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:   12 WGTGRRKTSVARVRLIPGNGLIKINGRAGDDYLNFNPLHLNSIKAPLQTLGLENSYDMYVNVFGGGLTGQADAIKQGAARALCELSPDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_ACAM1 (30S ribosomal protein S9 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsI PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-32
Identity = 74/124 (59.68%), Postives = 85/124 (68.55%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK +I RV L  G+G   IN +    YLQ NP ++   K PL +LG E  YDV V A GGGL+GQA AI LGVARAL ++  ++R PLK EG LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   14 GTGRRKSSIVRVRLVPGSGVMTINGKPGDLYLQFNPSYIANAKAPLESLGLENDYDVLVNARGGGLTGQADAIKLGVARALCELDPENRKPLKLEGYLTRDPRAKERKKYGLRKARKAPQYSKR 137          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_PROMA (30S ribosomal protein S9 OS=Prochlorococcus marinus GN=rpsI PE=3 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 2.735e-32
Identity = 73/129 (56.59%), Postives = 88/129 (68.22%), Query Frame = 2
Query:   95 AQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            A   +GTGRRK ++ARV L  GTGK  IN R    YL  NP +L  +K PL TLG   +YDV V  +GGGL+GQ+ AI  G ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:    8 AVVYWGTGRRKTSVARVRLIPGTGKITINGRPGDHYLNFNPAYLSAVKAPLHTLGLGEAYDVLVNVYGGGLTGQSDAIKQGAARALCELSVDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 136          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_SYNS9 (30S ribosomal protein S9 OS=Synechococcus sp. (strain CC9902) GN=rpsI PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.572e-32
Identity = 71/125 (56.80%), Postives = 85/125 (68.00%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G   IN R    YL  NP ++  +K PL TLG  T YDV V  HGGGL+GQ+ AI  G ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:    9 WGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYIAAVKAPLETLGLSTEYDVLVNVHGGGLTGQSGAIKQGAARALCELSADNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 133          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_SYNS3 (30S ribosomal protein S9 OS=Synechococcus sp. (strain CC9311) GN=rpsI PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.092e-32
Identity = 72/125 (57.60%), Postives = 84/125 (67.20%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G   IN R    YL  NP +L  +K PL TLG  T YDV V   GGGL+GQA AI  G ARAL ++S D+R PLK EG L+RD R  ER+K GL KARKAPQ+SKR
Sbjct:   11 WGTGRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYLAAVKAPLQTLGLSTEYDVLVNVRGGGLTGQADAIKQGAARALCELSVDNRKPLKTEGHLSRDPRAKERRKYGLKKARKAPQFSKR 135          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_THEFY (30S ribosomal protein S9 OS=Thermobifida fusca (strain YX) GN=rpsI PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.957e-32
Identity = 75/125 (60.00%), Postives = 91/125 (72.80%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDH-RSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV +  GTG++ IN +  +EY   N +  Q IK PL TLG+E +YDVF + +GGG SGQA A+  G+ARAL  +  +H R PLKK G LTRD+R VERKKAGL KARKAPQYSKR
Sbjct:   46 GTGRRKTAVARVRVVPGTGEWKINGKSLEEYFP-NKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHGLARALAAMDPEHNRPPLKKAGFLTRDARKVERKKAGLKKARKAPQYSKR 169          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_GLOVI1.228e-3256.5930S ribosomal protein S9 OS=Gloeobacter violaceus ... [more]
RS9_PROMS1.603e-3259.2030S ribosomal protein S9 OS=Prochlorococcus marinu... [more]
RS9_PROM51.603e-3258.4030S ribosomal protein S9 OS=Prochlorococcus marinu... [more]
RS9_PROMM2.094e-3257.6030S ribosomal protein S9 OS=Prochlorococcus marinu... [more]
RS9_PROM02.094e-3259.2030S ribosomal protein S9 OS=Prochlorococcus marinu... [more]
RS9_ACAM12.094e-3259.6830S ribosomal protein S9 OS=Acaryochloris marina (... [more]
RS9_PROMA2.735e-3256.5930S ribosomal protein S9 OS=Prochlorococcus marinu... [more]
RS9_SYNS93.572e-3256.8030S ribosomal protein S9 OS=Synechococcus sp. (str... [more]
RS9_SYNS36.092e-3257.6030S ribosomal protein S9 OS=Synechococcus sp. (str... [more]
RS9_THEFY7.957e-3260.0030S ribosomal protein S9 OS=Thermobifida fusca (st... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top