BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_HELHP (30S ribosomal protein S9 OS=Helicobacter hepaticus GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.964e-22
Identity = 57/126 (45.24%), Postives = 79/126 (62.70%), Query Frame = 2
Query:  104 IFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            ++ TG+RK AIA+V L  G+GK  IN +   ++L G+      +  PL+    E S D+     GGG S QA+A+  G+++AL       R+ LK +GLLTRDSRVVERKK G  KAR++PQ+SKR
Sbjct:    4 VYATGKRKTAIAKVWLTSGSGKLNINGQSLNDWLGGHEAIKMKVMQPLILTKQEKSVDIHAVTLGGGYSAQAEALRHGISKALNAYDVAFRAMLKPKGLLTRDSRVVERKKYGKRKARRSPQFSKR 129          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_CHLAB (30S ribosomal protein S9 OS=Chlamydophila abortus GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.964e-22
Identity = 60/125 (48.00%), Postives = 79/125 (63.20%), Query Frame = 2
Query:  113 TGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKV--PLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            TGRRK A++ V L+ GTGK  +N +   EY    PL +Q + +  PL  LGY   +D+ ++ +GGG+ GQ  A  LG+ARALLK + D +  LK  G LTRD R  ERKK G  KARK+ Q+SKR
Sbjct:   12 TGRRKQAVSSVRLRPGTGKIDVNGKAFDEYF---PLEIQRVTILSPLKVLGYSNDFDLVIRINGGGIQGQVIATRLGLARALLKKNVDSKQELKSHGFLTRDPRKKERKKYGHKKARKSFQFSKR 133          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BORPD (30S ribosomal protein S9 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.964e-22
Identity = 53/125 (42.40%), Postives = 78/125 (62.40%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV +++G+GK I+N +   E+          ++ PL   G+  S+D+ V  HGGG +GQA A+  G+ RAL+    D +  L + G +TRD+R VERKK G  KAR+  Q+SKR
Sbjct:    7 YGTGRRKTSVARVFIKKGSGKIIVNGKPVDEFF-ARETGRMIVRQPLELTGHLESFDIKVNVHGGGETGQAGAVRHGITRALIDYDADLKPALSQAGFVTRDAREVERKKVGFRKARRRKQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RR9_ODOSI (30S ribosomal protein S9, chloroplastic OS=Odontella sinensis GN=rps9 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.964e-22
Identity = 55/108 (50.93%), Postives = 71/108 (65.74%), Query Frame = 2
Query:  158 GTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            G G  +IN    ++YLQ N  +L+ I  PL  L  E  +D+     GGGL+GQ ++I LGVAR L +++  +RS LK  G LTRD+R+ ERKK GL KARKAPQYSKR
Sbjct:   31 GEGNIVINKVSGEKYLQYNLTYLKDIWAPLKELNLEKQFDIIALVRGGGLTGQTESIQLGVARLLCQMNPQNRSVLKPFGFLTRDARIKERKKYGLRKARKAPQYSKR 138          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_THIDA (30S ribosomal protein S9 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.566e-22
Identity = 54/125 (43.20%), Postives = 76/125 (60.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV ++ G+GK ++N +   EY          ++ PLV       +D+ V   GGG SGQA A+  G+ RAL+ +    +  LK  GL+TRD+R VERKK G HKAR+  Q+SKR
Sbjct:    7 YGTGRRKSSVARVFIKAGSGKIVVNDKPVDEYFS-RETGRMIVRQPLVLTDNLNRFDIMVNVAGGGESGQAGAVRHGITRALIDLDAGMKPTLKAAGLVTRDAREVERKKVGFHKARRRKQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_RALME (30S ribosomal protein S9 OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.566e-22
Identity = 55/125 (44.00%), Postives = 76/125 (60.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV ++ G G  I+N +  KEY       L  ++ PL    +  ++D+ V   GGG +GQA A+  G+ RAL+      +  L K G +TRD+R VERKK GLHKAR+  Q+SKR
Sbjct:    7 YGTGRRKSAVARVFIKSGKGDIIVNGKPIKEYF-ARETSLMIVRQPLELTAHAETFDIKVNVTGGGETGQAGAVRHGITRALIDYDATLKPTLSKAGYVTRDAREVERKKVGLHKARRRKQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_NITWN (30S ribosomal protein S9 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.566e-22
Identity = 59/125 (47.20%), Postives = 77/125 (61.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            + TG+RK A+ARV ++ G GK ++N R+   Y    P+    I+ PLV       YDV     GGGLSGQA A+  G+++AL     + R  LKK G LTRDSRVVERKK G  KAR++ Q+SKR
Sbjct:   35 YATGKRKDAVARVWIKPGAGKILVNAREVDVYF-ARPVLRMMIQQPLVAAARAGQYDVVCTVAGGGLSGQAGAVRHGLSKALTHFEPELRGVLKKGGFLTRDSRVVERKKYGKAKARRSFQFSKR 158          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_HALHL (30S ribosomal protein S9 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.566e-22
Identity = 56/130 (43.08%), Postives = 77/130 (59.23%), Query Frame = 2
Query:   92 AAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            A Q  +GTGRRK + ARV +  G G   +N R   EY  G       ++  L  +     +D+     GGG SGQA A+  G+ARAL     + ++PL++ G +TRD+R+VERKK GLHKAR+A Q+SKR
Sbjct:    2 ANQQYYGTGRRKTSAARVFMTPGNGNITVNGRPLDEYF-GRETGRMIVRQALEQVDAGDKFDIKATVSGGGSSGQAGAVRHGIARALANYDAELKAPLRRAGFITRDARMVERKKIGLHKARRATQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_FLAPJ (30S ribosomal protein S9 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.566e-22
Identity = 57/122 (46.72%), Postives = 79/122 (64.75%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRKCA+ARV + EGTG   +N +    Y     L  + ++ P+      T+YDV V  +GGG +GQA+A+ + +AR + +V + +R+ LK EGLLTRD R+VERKK G  KARK  Q+SKR
Sbjct:    8 GRRKCAVARVYVSEGTGVITVNKKAFATYFPTATLQYKVLQ-PMSMTENVTNYDVKVNVYGGGSTGQAEAVRMALARVMCEVGEGNRAILKPEGLLTRDPRMVERKKFGQKKARKRFQFSKR 128          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_CUPTR (30S ribosomal protein S9 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsI PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.566e-22
Identity = 54/125 (43.20%), Postives = 76/125 (60.80%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV ++ G G  ++N +  KEY       L  ++ PL    +  ++D+ V   GGG +GQA A+  G+ RAL+      +S L K G +TRD+R VERKK G HKAR+  Q+SKR
Sbjct:    7 YGTGRRKSAVARVFIKSGKGDIVVNGKPIKEYF-ARETSLMIVRQPLELTAHAETFDIKVNVTGGGETGQAGAVRHGITRALIDYDATLKSALSKAGYVTRDAREVERKKVGFHKARRRKQFSKR 130          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_HELHP1.964e-2245.2430S ribosomal protein S9 OS=Helicobacter hepaticus... [more]
RS9_CHLAB1.964e-2248.0030S ribosomal protein S9 OS=Chlamydophila abortus ... [more]
RS9_BORPD1.964e-2242.4030S ribosomal protein S9 OS=Bordetella petrii (str... [more]
RR9_ODOSI1.964e-2250.9330S ribosomal protein S9, chloroplastic OS=Odontel... [more]
RS9_THIDA2.566e-2243.2030S ribosomal protein S9 OS=Thiobacillus denitrifi... [more]
RS9_RALME2.566e-2244.0030S ribosomal protein S9 OS=Ralstonia metalliduran... [more]
RS9_NITWN2.566e-2247.2030S ribosomal protein S9 OS=Nitrobacter winogradsk... [more]
RS9_HALHL2.566e-2243.0830S ribosomal protein S9 OS=Halorhodospira halophi... [more]
RS9_FLAPJ2.566e-2246.7230S ribosomal protein S9 OS=Flavobacterium psychro... [more]
RS9_CUPTR2.566e-2243.2030S ribosomal protein S9 OS=Cupriavidus taiwanensi... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top