BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRPC (30S ribosomal protein S9 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/124 (57.26%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRPB (30S ribosomal protein S9 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/124 (57.26%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRP8 (30S ribosomal protein S9 OS=Streptococcus pyogenes serotype M18 GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/124 (57.26%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRP6 (30S ribosomal protein S9 OS=Streptococcus pyogenes serotype M6 GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/124 (57.26%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRP3 (30S ribosomal protein S9 OS=Streptococcus pyogenes serotype M3 GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/124 (57.26%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRP1 (30S ribosomal protein S9 OS=Streptococcus pyogenes serotype M1 GN=rpsI PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.234e-29
Identity = 71/124 (57.26%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P      E SYDVFV   GGG  GQ+ AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-IINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_ONYPE (30S ribosomal protein S9 OS=Onion yellows phytoplasma GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.075e-28
Identity = 71/125 (56.80%), Postives = 88/125 (70.40%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            FGTGRRK A+ARV+L  GTGK  IN RD ++YL      L+ I+ PL       ++DV V  +GGGLS QA AI LG+ARAL++   + R+ LKK GLLTRD+R VERKK GL KAR+APQ+SKR
Sbjct:    7 FGTGRRKSAVARVILTNGTGKITINTRDFEKYLPLPATRLEMIQ-PLELTEKREAFDVSVNVNGGGLSAQAGAIRLGIARALIESVPELRAILKKAGLLTRDARCVERKKYGLKKARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_GEOKA (30S ribosomal protein S9 OS=Geobacillus kaustophilus GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.075e-28
Identity = 68/125 (54.40%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G+ I+N RD +EY+    L ++ +K PLV      SYDV V   GGG +GQA AI  G+ARALL+V  + R+ LK+ GLLTRD+RV ERKK GL  AR+APQ+SKR
Sbjct:    7 YGTGRRKSSVARVRLVPGDGRIIVNKRDIREYIPTEAL-IEMVKQPLVLTETLGSYDVLVNVQGGGFAGQAGAIRHGIARALLEVDPEFRTVLKRAGLLTRDARVKERKKYGLKGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RR9_PHATR (30S ribosomal protein S9, chloroplastic OS=Phaeodactylum tricornutum GN=rps9 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.075e-28
Identity = 69/124 (55.65%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            G G+RK +IARV L  G GK IIN     +YLQ N  +L  +  PL  L  E  +D+     GGGL+GQAQAI LGVAR L  + +++RS LK  G LTRDSR+ ERKK GL KARKAPQYSKR
Sbjct:   15 GLGKRKQSIARVFLLPGDGKIIINKTSGNKYLQYNDNYLNTVWSPLEKLNLEKQFDIVALVQGGGLTGQAQAIQLGVARLLCTMDKENRSILKPFGFLTRDSRIKERKKYGLRKARKAPQYSKR 138          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRSV (30S ribosomal protein S9 OS=Streptococcus sanguinis (strain SK36) GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 72/124 (58.06%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQA AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTAGSYDVFVNVVGGGYAGQAGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_STRPC8.234e-2957.2630S ribosomal protein S9 OS=Streptococcus pyogenes... [more]
RS9_STRPB8.234e-2957.2630S ribosomal protein S9 OS=Streptococcus pyogenes... [more]
RS9_STRP88.234e-2957.2630S ribosomal protein S9 OS=Streptococcus pyogenes... [more]
RS9_STRP68.234e-2957.2630S ribosomal protein S9 OS=Streptococcus pyogenes... [more]
RS9_STRP38.234e-2957.2630S ribosomal protein S9 OS=Streptococcus pyogenes... [more]
RS9_STRP18.234e-2957.2630S ribosomal protein S9 OS=Streptococcus pyogenes... [more]
RS9_ONYPE1.075e-2856.8030S ribosomal protein S9 OS=Onion yellows phytopla... [more]
RS9_GEOKA1.075e-2854.4030S ribosomal protein S9 OS=Geobacillus kaustophil... [more]
RR9_PHATR1.075e-2855.6530S ribosomal protein S9, chloroplastic OS=Phaeoda... [more]
RS9_STRSV1.404e-2858.0630S ribosomal protein S9 OS=Streptococcus sanguini... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top