BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCA1 (30S ribosomal protein S9 OS=Mycobacterium avium (strain 104) GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 70/122 (57.38%), Postives = 81/122 (66.39%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRK A+ RV L  GTGKF +N R  + Y   N +  Q IK PLVT+    S+D++   HGGG SGQA A+ LG+ARAL+  S D R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   46 GRRKEAVVRVRLVPGTGKFNLNGRTLEGYFP-NKVHQQLIKAPLVTVDRVDSFDIYAHLHGGGPSGQAGALRLGIARALILASPDDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 166          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_LYSSC (30S ribosomal protein S9 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 69/124 (55.65%), Postives = 86/124 (69.35%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK ++ARV L  GTGK +IN R+ +EY+    L  + IK PLV      SYD+ V  +GGG +GQA A+  G+ARALL+V  D R+ LK  GLLTRDSR+ ERKK GL  AR+APQ+SKR
Sbjct:    8 GTGRRKSSVARVRLVPGTGKIVINKREIEEYVPFAAL-REVIKQPLVATETTGSYDIHVNVNGGGYTGQAGAVRHGIARALLQVDPDFRAALKSAGLLTRDSRMKERKKPGLRGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_LISMO (30S ribosomal protein S9 OS=Listeria monocytogenes GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 70/125 (56.00%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G GK +IN RD ++Y+    L  + IK PLV      +YDV V  HGGG +GQA AI  GVARALL+V+ ++R  LK  GLLTRDSR+ ERKK GL  AR+APQ+SKR
Sbjct:    7 YGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAAL-REVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLLTRDSRMKERKKPGLKGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BIFLO (30S ribosomal protein S9 OS=Bifidobacterium longum GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 73/134 (54.48%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 GGFAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQD-HRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            G  A +  +GTGRRK A+ARV L  G GK+ IN R  +EY     L  + +  P+V L  E  +D  V   GGG +GQA AI LGVARAL  + +D +R+ LKK G LTRD+RVVERKKAGLHKAR+APQ+SKR
Sbjct:   31 GTSAIEPGYGTGRRKEAVARVRLVPGDGKWTINGRTLEEYFPSKLLQRE-VNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR 163          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BIFLI (30S ribosomal protein S9 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / NCTC 11817 / S12) GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 73/134 (54.48%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 GGFAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQD-HRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            G  A +  +GTGRRK A+ARV L  G GK+ IN R  +EY     L  + +  P+V L  E  +D  V   GGG +GQA AI LGVARAL  + +D +R+ LKK G LTRD+RVVERKKAGLHKAR+APQ+SKR
Sbjct:   31 GTSAIEPGYGTGRRKEAVARVRLVPGDGKWTINGRTLEEYFPSKLLQRE-VNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR 163          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BIFLD (30S ribosomal protein S9 OS=Bifidobacterium longum (strain DJO10A) GN=rpsI PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.404e-28
Identity = 73/134 (54.48%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 GGFAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQD-HRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            G  A +  +GTGRRK A+ARV L  G GK+ IN R  +EY     L  + +  P+V L  E  +D  V   GGG +GQA AI LGVARAL  + +D +R+ LKK G LTRD+RVVERKKAGLHKAR+APQ+SKR
Sbjct:   31 GTSAIEPGYGTGRRKEAVARVRLVPGDGKWTINGRTLEEYFPSKLLQRE-VNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR 163          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BACA2 (30S ribosomal protein S9 OS=Bacillus amyloliquefaciens (strain FZB42) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.834e-28
Identity = 65/125 (52.00%), Postives = 88/125 (70.40%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G+ ++N R+  E++  +P  ++ IK PL       +YDV V  HGGGLSGQA AI  G+ARALL+   ++R+ LK+ GLLTRD+R+ ERKK GL  AR+APQ+SKR
Sbjct:    7 YGTGRRKSSVARVRLVPGEGRIVVNNREISEHIP-SPALIEDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRATLKRAGLLTRDARMKERKKYGLKGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_ANOFW (30S ribosomal protein S9 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.834e-28
Identity = 68/125 (54.40%), Postives = 87/125 (69.60%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK ++ARV L  G G+ I+N RD ++Y+    L ++ +K PLV      SYDV V   GGG +GQA AI  G+ARALL+V  ++R  LK+ GLLTRDSRV ERKK GL  AR+APQ+SKR
Sbjct:    7 YGTGRRKSSVARVRLVPGEGRIIVNGRDIRDYVPYESL-VEVVKQPLVLTETFGSYDVLVNVSGGGFTGQAGAIRHGIARALLQVDPEYRQTLKRAGLLTRDSRVKERKKYGLKGARRAPQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRGC (30S ribosomal protein S9 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P         YDVFV  +GGG  GQA AI  G+ARALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGQYDVFVNVNGGGYGGQAGAIRHGIARALLQVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRA5 (30S ribosomal protein S9 OS=Streptococcus agalactiae serotype V GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  IN +D +EY+    L L  I  P      + SYDVFV   GGG +GQ+ AI  G++RALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITINKKDVEEYIPHADLRL-VINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_MYCA11.404e-2857.3830S ribosomal protein S9 OS=Mycobacterium avium (s... [more]
RS9_LYSSC1.404e-2855.6530S ribosomal protein S9 OS=Lysinibacillus sphaeri... [more]
RS9_LISMO1.404e-2856.0030S ribosomal protein S9 OS=Listeria monocytogenes... [more]
RS9_BIFLO1.404e-2854.4830S ribosomal protein S9 OS=Bifidobacterium longum... [more]
RS9_BIFLI1.404e-2854.4830S ribosomal protein S9 OS=Bifidobacterium longum... [more]
RS9_BIFLD1.404e-2854.4830S ribosomal protein S9 OS=Bifidobacterium longum... [more]
RS9_BACA21.834e-2852.0030S ribosomal protein S9 OS=Bacillus amyloliquefac... [more]
RS9_ANOFW1.834e-2854.4030S ribosomal protein S9 OS=Anoxybacillus flavithe... [more]
RS9_STRGC2.396e-2856.4530S ribosomal protein S9 OS=Streptococcus gordonii... [more]
RS9_STRA52.396e-2856.4530S ribosomal protein S9 OS=Streptococcus agalacti... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top