BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRA3 (30S ribosomal protein S9 OS=Streptococcus agalactiae serotype III GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  IN +D +EY+    L L  I  P      + SYDVFV   GGG +GQ+ AI  G++RALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITINKKDVEEYIPHADLRL-VINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRA1 (30S ribosomal protein S9 OS=Streptococcus agalactiae serotype Ia GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  IN +D +EY+    L L  I  P      + SYDVFV   GGG +GQ+ AI  G++RALL+V  D R  LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITINKKDVEEYIPHADLRL-VINQPFAVTSTQGSYDVFVNVVGGGYAGQSGAIRHGISRALLEVDPDFRDSLKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCTU (30S ribosomal protein S9 OS=Mycobacterium tuberculosis GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/122 (57.38%), Postives = 82/122 (67.21%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    S+D+F    GGG SGQA A+ LG+ARAL+ VS + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   31 GRRKEAVVRVRLVPGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVDRVESFDIFAHLGGGGPSGQAGALRLGIARALILVSPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 151          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCTA (30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/122 (57.38%), Postives = 82/122 (67.21%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    S+D+F    GGG SGQA A+ LG+ARAL+ VS + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   31 GRRKEAVVRVRLVPGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVDRVESFDIFAHLGGGGPSGQAGALRLGIARALILVSPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 151          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCBT (30S ribosomal protein S9 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/122 (57.38%), Postives = 82/122 (67.21%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    S+D+F    GGG SGQA A+ LG+ARAL+ VS + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   31 GRRKEAVVRVRLVPGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVDRVESFDIFAHLGGGGPSGQAGALRLGIARALILVSPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 151          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCBP (30S ribosomal protein S9 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/122 (57.38%), Postives = 82/122 (67.21%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    S+D+F    GGG SGQA A+ LG+ARAL+ VS + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   31 GRRKEAVVRVRLVPGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVDRVESFDIFAHLGGGGPSGQAGALRLGIARALILVSPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 151          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCBO (30S ribosomal protein S9 OS=Mycobacterium bovis GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/122 (57.38%), Postives = 82/122 (67.21%), Query Frame = 2
Query:  116 GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    S+D+F    GGG SGQA A+ LG+ARAL+ VS + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   31 GRRKEAVVRVRLVPGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVDRVESFDIFAHLGGGGPSGQAGALRLGIARALILVSPEDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR 151          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_LACLS (30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N R+ + Y+    + L  I  P      E SYD  V  +GGG+SGQA AI  G+ARALL+V  D RS LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNGREVESYIPHADMRL-VINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_LACLM (30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N R+ + Y+    + L  I  P      E SYD  V  +GGG+SGQA AI  G+ARALL+V  D RS LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNGREVESYIPHADMRL-VINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_LACLA (30S ribosomal protein S9 OS=Lactococcus lactis subsp. lactis GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 70/124 (56.45%), Postives = 84/124 (67.74%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N R+ + Y+    + L  I  P      E SYD  V  +GGG+SGQA AI  G+ARALL+V  D RS LK+ GLLTRD+R+VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNGREVESYIPHADMRL-VINQPFAATQTEGSYDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSKR 130          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_STRA32.396e-2856.4530S ribosomal protein S9 OS=Streptococcus agalacti... [more]
RS9_STRA12.396e-2856.4530S ribosomal protein S9 OS=Streptococcus agalacti... [more]
RS9_MYCTU2.396e-2857.3830S ribosomal protein S9 OS=Mycobacterium tubercul... [more]
RS9_MYCTA2.396e-2857.3830S ribosomal protein S9 OS=Mycobacterium tubercul... [more]
RS9_MYCBT2.396e-2857.3830S ribosomal protein S9 OS=Mycobacterium bovis (s... [more]
RS9_MYCBP2.396e-2857.3830S ribosomal protein S9 OS=Mycobacterium bovis (s... [more]
RS9_MYCBO2.396e-2857.3830S ribosomal protein S9 OS=Mycobacterium bovis GN... [more]
RS9_LACLS2.396e-2856.4530S ribosomal protein S9 OS=Lactococcus lactis sub... [more]
RS9_LACLM2.396e-2856.4530S ribosomal protein S9 OS=Lactococcus lactis sub... [more]
RS9_LACLA2.396e-2856.4530S ribosomal protein S9 OS=Lactococcus lactis sub... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top