BQ622924

Overview
NameBQ622924
Unique NameBQ622924
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622924_ssr546 microsatellite BQ622924_ssr546:546..566. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3539 contig Csv1_Contig3539:145..814. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_BIFA0 (30S ribosomal protein S9 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.396e-28
Identity = 71/126 (56.35%), Postives = 88/126 (69.84%), Query Frame = 2
Query:  107 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQD-HRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            +GTGRRK A+ARV L  GTG++ IN R  +EY     L  + +  P+V L  E  +D  V   GGG +GQA AI LGVARAL  + +D +R+ LKK G LTRD+RVVERKKAGLHKAR+APQ+SKR
Sbjct:   39 YGTGRRKEAVARVRLVPGTGEWKINGRTLEEYFPSKLLQRE-VNSPIVLLKLEGKFDAIVLVDGGGTTGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR 163          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCLE (30S ribosomal protein S9 OS=Mycobacterium leprae GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.129e-28
Identity = 70/128 (54.69%), Postives = 85/128 (66.41%), Query Frame = 2
Query:   98 QTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            ++I   GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    ++D+F   HGGG SGQA A+ LG+ARAL+  S + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   27 RSIQTVGRRKEAVVRVRLVLGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAGALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQYSKR 153          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_MYCLB (30S ribosomal protein S9 OS=Mycobacterium leprae (strain Br4923) GN=rpsI PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.129e-28
Identity = 70/128 (54.69%), Postives = 85/128 (66.41%), Query Frame = 2
Query:   98 QTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            ++I   GRRK A+ RV L  GTGKF +N R  ++Y   N +  Q IK PLVT+    ++D+F   HGGG SGQA A+ LG+ARAL+  S + R  LKK G LTRD R  ERKK GL KARKAPQYSKR
Sbjct:   27 RSIQTVGRRKEAVVRVRLVLGTGKFDLNGRSLEDYFP-NKVHQQLIKAPLVTVERTRNFDIFALLHGGGPSGQAGALRLGIARALILASPEDRPALKKAGFLTRDPRSTERKKYGLKKARKAPQYSKR 153          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRZT (30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRZP (30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain P1031) GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRZJ (30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain JJA) GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRR6 (30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRPS (30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRPN (30S ribosomal protein S9 OS=Streptococcus pneumoniae GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Match: RS9_STRPJ (30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsI PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.086e-28
Identity = 71/124 (57.26%), Postives = 82/124 (66.13%), Query Frame = 2
Query:  110 GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKVSQDHRSPLKKEGLLTRDSRVVERKKAGLHKARKAPQYSKR 481
            GTGRRK A+ARV L  GTGK  +N +D +EY+    L L  I  P        SYDVFV   GGG +GQ+ AI  G+ARALL+V  D R  LK+ GLLTRDSR VERKK GL KARKA Q+SKR
Sbjct:    8 GTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRL-VINQPFAVTSTVGSYDVFVNVIGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLLTRDSRKVERKKPGLKKARKASQFSKR 130          
The following BLAST results are available for this feature:
BLAST of BQ622924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RS9_BIFA02.396e-2856.3530S ribosomal protein S9 OS=Bifidobacterium animal... [more]
RS9_MYCLE3.129e-2854.6930S ribosomal protein S9 OS=Mycobacterium leprae G... [more]
RS9_MYCLB3.129e-2854.6930S ribosomal protein S9 OS=Mycobacterium leprae (... [more]
RS9_STRZT4.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]
RS9_STRZP4.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]
RS9_STRZJ4.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]
RS9_STRR64.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]
RS9_STRPS4.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]
RS9_STRPN4.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]
RS9_STRPJ4.086e-2857.2630S ribosomal protein S9 OS=Streptococcus pneumoni... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00015 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622924 ID=BQ622924|Name=BQ622924|organism=Citrus sinensis|type=EST|length=670bp
ACTGGTAGTATCGGCCACAGAAGCTGCGCCAGCTGAACTGGAAACAACTG
ACCTCAAGAAATACGTCAAGTCGAGGCTTCCCGGTGGCTTTGCGGCTCAA
ACTATTTTTGGAACGGGCCGTCGGAAATGCGCCATTGCTCGTGTCGTCCT
CCAAGAAGGCACCGGCAAATTCATCATCAACTACCGCGATGCCAAGGAAT
ATCTTCAAGGCAATCCACTATGGCTACAGTATATAAAAGTCCCTTTGGTA
ACTTTGGGTTATGAAACTAGCTATGATGTTTTTGTGAAAGCTCATGGTGG
CGGCCTCTCTGGTCAAGCTCAAGCAATAACACTCGGCGTTGCTCGTGCAT
TGTTGAAGGTGAGCCAGGACCATAGATCCCCTCTGAAAAAGGAAGGCCTT
CTGACTAGAGATTCCAGAGTAGTAGAGAGGAAAAAAGCTGGACTCCATAA
AGCCCGCAAAGCCCCACAGTATTCCAAACGTTGAGGCCAGAATTACAGTG
TGATGGACTGTTACCCGTAGATCTATTTTCTGCTTGTATCTCTGAATTAT
TATTATTATTATTATTTTTGGTTTAACATTTTATGTTTGGAGTTTTGTAC
TTCAGTTCCGGGTATCATGGAATCATAAACCATTTTTGATAAAAAAAACC
TAACAAAACAACTACAAAAA
back to top