BQ622997
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB31_ARATH (Myrosinase-binding protein-like At3g16470 OS=Arabidopsis thaliana GN=At3g16470 PE=1 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 2.617e-12 Identity = 28/76 (36.84%), Postives = 45/76 (59.21%), Query Frame = 1 Query: 241 PEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468 P+E++ +VSGYY I + SL F++NKR P+GL+ G F L I GF+G++ +L +GV++ P+ Sbjct: 374 PDEYVTAVSGYYDKIFSVDAPAIVSLKFKTNKRTSIPYGLEGGTEFVLEKKDHKIVGFYGQAGEYLYKLGVNVAPI 449 HSP 2 Score: 32.3426 bits (72), Expect = 2.617e-12 Identity = 15/48 (31.25%), Postives = 23/48 (47.92%), Query Frame = 3 Query: 57 GGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKKGSSVWSDKHG 197 GG WDDGV SV+++ + G + + +Y+K V HG Sbjct: 313 GGDGGVAWDDGVHDSVKKIYVGQGDSCVTYFKADYEKASKPVLGSDHG 360 The following BLAST results are available for this feature:
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ622997 ID=BQ622997; Name=BQ622997; organism=Citrus sinensis; type=EST; length=661bpback to top |