BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.624e-14
Identity = 52/177 (29.38%), Postives = 89/177 (50.28%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL---INPNESITMD 504
            TTS ++      L +HP+  + +  E    +   R  E     D++ + Y   V +ES+RL PP+ F   R+ + D ++ G+ +PK  +VL  A+    +PE ++DP+SF P RF     +     Y  +PFG G R+C G  L    +   +  ++  ++W L   ++P +SI MD
Sbjct:  313 TTSSSVEWALTELLRHPEAMAKVKTEISQAIEPNRKFED---SDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGYDVPKDTQVLVNAWAIGRDPECWDDPMSFKPERFLGSKIDVKGQHYGLIPFGAGRRMCVGLPLGHRMMHFALGSLLREFEWELPDGVSP-KSINMD 485          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71DI_MENSP (Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.624e-14
Identity = 46/185 (24.86%), Postives = 88/185 (47.57%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIK 540
            T+S  I+     L ++P   + + +    +    +   ++ L +++++KY   V +E++RL PP     R++  + E  G+TIP   ++    +    +P+Y+EDP +F P RF+E    ++     ++PFG G R+C G      N+ I +  ++  +DW L        +D    P    P K
Sbjct:  302 TSSTTISWALSELMRNP---AKMAKVQAEVREALKGKTVVDLSEVQELKYLRSVLKETLRLHPPFPLIPRQSREECEVNGYTIPAKTRIFINVWAIGRDPQYWEDPDTFRPERFDEVSRDFMGNDFEFIPFGAGRRICPGLHFGLANVEIPLAQLLYHFDWKLPQGMTDADLDMTETPGLSGPKK 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C71DI_MENGR (Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.624e-14
Identity = 46/185 (24.86%), Postives = 88/185 (47.57%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIK 540
            T+S  I+     L ++P   + + +    +    +   ++ L +++++KY   V +E++RL PP     R++  + E  G+TIP   ++    +    +P+Y+EDP +F P RF+E    ++     ++PFG G R+C G      N+ I +  ++  +DW L        +D    P    P K
Sbjct:  302 TSSTTISWALSELMRNP---AKMAKVQAEVREALKGKTVVDLSEVQELKYLRSVLKETLRLHPPFPLIPRQSREECEVNGYTIPAKTRIFINVWAIGRDPQYWEDPDTFRPERFDEVSRDFMGNDFEFIPFGAGRRICPGLHFGLANVEIPLAQLLYHFDWKLPQGMTDADLDMTETPGLSGPKK 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F2_HUMAN (Leukotriene-B(4) omega-hydroxylase 1 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.122e-14
Identity = 47/152 (30.92%), Postives = 78/152 (51.32%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAG--YQLAKLNIII 435
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+  + +     +ES+RL PP+    R    DI   +G  IPKG   L + FGTH NP  + DP  +DP RF+    +   P  ++PF  GPR C G  + +A++ +++
Sbjct:  332 TTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEI-EWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6B4_PAPGL (Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.619e-14
Identity = 58/192 (30.21%), Postives = 97/192 (50.52%), Query Frame = 1
Query:   13 AIAMTFKM--LAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE-ESV---PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNES-ITMDP---LPFPSQGMPIKISPK 552
            A  M+F +  LA++PD    ++ E V+    +  GEI T + + ++ Y  QV  E++R +P      R A +D    G   T+ KG  V+ + FG H +P+Y+ DP  FDP RF  E+V    P  Y+PFG G R C G +  +  + + +  +++++ +       S    DP   L +P  G+ + I P+
Sbjct:  309 ASTMSFLLFELAENPDIQEKVIAE-VDETLKRHNGEI-TYDTLSEMTYLTQVFHETLRKYPVADILLRNAKADYAVPGTNVTLKKGQTVVVSGFGIHYDPKYYPDPEKFDPERFSPENVRNRHPCAYIPFGAGQRKCLGMRFGQWQVQVCIIKLLSKFRFEPSTKTMSEFNYDPKRLLVYPKSGIFLNIIPR 498          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4C1_BLADI (Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.619e-14
Identity = 51/191 (26.70%), Postives = 89/191 (46.60%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-EESVP---PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITM--DPLPFPSQGMPIKISPKL 555
            TTS  I     +L  HP+    + +E  +I     +    T+ D+  +KY  +V +ES+RLFP +    R    D +   + +P G  +    +  H N + + +P +F+P  F  E V    PY Y+PF  GPR C G + A L     +  ++  +    I   E +T+  + +  P  G+ +++ P+L
Sbjct:  318 TTSAGICWALFLLGSHPEIQDKVYEELDHIFQG--SDRSTTMRDLADMKYLERVIKESLRLFPSVPFIGRVLKEDTKIGDYLVPAGCMMNLQIYHVHRNQDQYPNPEAFNPDNFLPERVAKRHPYAYVPFSAGPRNCIGQKFATLEEKTVLSSILRNFKVRSIEKREDLTLMNELILRPESGIKVELIPRL 506          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CCD1D_DROME (Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.619e-14
Identity = 46/150 (30.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--------EESVPPYVYLPFGGGPRLCAGYQLAKLNI 429
            T+  ++     L++HPD  + L +E ++IM  K +  +L  E+MK + Y   V +E++R +P  FG+ R   +D+   G+ +PKG  VL  +        Y+  P  F P R+        +  V P+ +LPFG GPR+C G ++  L +
Sbjct:  330 TATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDS--LLNEENMKDMPYLRAVIKETLRYYPNGFGTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEM 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4X1_RAT (Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.726e-14
Identity = 42/123 (34.15%), Postives = 64/123 (52.03%), Query Frame = 1
Query:  109 GEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            G  +T E + +I YT    +E++RL PPI    R+    +   +G ++P G  V+ + +G H NP  ++DP  FDP RF     E   P  +LPF  GPR C G Q A L + + +   + R+
Sbjct:  351 GSSITWEQLDEIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKDPKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRF 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4S3_DROME (Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.726e-14
Identity = 43/146 (29.45%), Postives = 72/146 (49.32%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF---EESVPPYVYLPFGGGPRLCAGYQLAKLNI 429
            TTS AIA    +L+++PD      +E   +   ++          + + Y   V +E++R++P +    RK + D+E    T+PKG  +    +  H +P+ F DP  FDP RF   E+ + P+ +  F  GPR C G + A L +
Sbjct:  311 TTSSAIAFALSLLSKNPDVQQRAFEEASELEGREK----------ESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRNCIGQKFAMLEL 446          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4FE_MOUSE (Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.726e-14
Identity = 48/159 (30.19%), Postives = 77/159 (48.43%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  ++     LA+HP+      QE   ++  +   EI   +D+ ++ +     +ES+RL PP+    R    DI   +G TIPKG   L + FG H NP  + DP  +DP RF+    +   P  ++PF  GPR C G   A   + + +   + R+
Sbjct:  332 TTASGLSWILYNLARHPEYQERCRQEVQELLRGREPEEI-EWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVWPDPEVYDPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRF 489          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C76A2_SOLME1.624e-1429.38Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
C71DI_MENSP1.624e-1424.86Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D1... [more]
C71DI_MENGR1.624e-1424.86Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D... [more]
CP4F2_HUMAN2.122e-1430.92Leukotriene-B(4) omega-hydroxylase 1 OS=Homo sapie... [more]
CP6B4_PAPGL3.619e-1430.21Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 P... [more]
CP4C1_BLADI3.619e-1426.70Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP... [more]
CCD1D_DROME3.619e-1430.67Probable cytochrome P450 12d1 distal, mitochondria... [more]
CP4X1_RAT4.726e-1434.15Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1... [more]
CP4S3_DROME4.726e-1429.45Probable cytochrome P450 4s3 OS=Drosophila melanog... [more]
CP4FE_MOUSE4.726e-1430.19Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top