BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C6A23_DROME (Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 8.913e-13
Identity = 48/164 (29.27%), Postives = 77/164 (46.95%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            T+S  +      LA   D    L  E  N+++  +     T E +K++KY  QV  E++R +P +    R   +D   E   + I KG  V+  A G H +PE + +P  F P RF +      P   +LPFG GPR C G +   +   + + Y++  Y +S+
Sbjct:  309 TSSTTMGFALYELALDQDIQDQLRAEINNVLS--KHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSV 470          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C27C1_HUMAN (Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.913e-13
Identity = 49/186 (26.34%), Postives = 88/186 (47.31%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            TTSF ++ T  +LA+HP+    + +E   I+ N     + T  D+ K+     + +E++RLFP + G+ R    D+   G+ IPKG ++    + T    E F     F P R+      + V  +  +PFG G R C G ++A+L I + V  ++  ++    +   ++        + G PI +
Sbjct:  184 TTSFTLSWTVYILARHPEVQQTVYRE---IVKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAVHAKTHGLLTPGGPIHV 366          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP52F_CANTR (Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 56/184 (30.43%), Postives = 90/184 (48.91%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQE-HVNI-MNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY---------EGFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRR-FEESVPP--YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDP 507
            TT+  ++     LA+HP+ +S L +E  VN  +  +   E +T E +K+ +Y   +  E++R++P +  + R A  D            +   IPKG  V +  + TH   EY+ +D   F P R FE S     + Y+PF GGPR+C G Q A    +    YV+TR    L+   E+++  P
Sbjct:  325 TTAGLLSFAMFELARHPEIWSKLREEIEVNFGVGEESRVEEITFESLKRCEYLKAILNETLRMYPSVPVNSRTATRDTTLPRGGGPNGTDPIFIPKGSTVAYIVYKTHRLEEYYGKDADDFRPERWFEPSTKKLGWAYVPFNGGPRICLGQQFA----LTEASYVITR----LVQMFETVSSPP 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F3_RAT (Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 46/159 (28.93%), Postives = 76/159 (47.80%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP     R    DI   +G  IPKG     + FGTH NP  + DP  ++P RF+    +   P  ++PF  GPR C G   A   + + +   + R+
Sbjct:  332 TTASGLSWILYNLAKHPEYQERCRQEVRELLRDREPEEI-EWDDLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGRVIPKGVICRISIFGTHHNPAVWPDPEVYNPFRFDADNGKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRF 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AM_HUMAN (Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 44/142 (30.99%), Postives = 74/142 (52.11%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLA 417
            TT+  I+     LA HP       +E   ++ +   G  +T   + ++ YT    +E++RL+PP+ G  R+  + + + +G ++PKG  VL + +G H NP+ + +   FDP RF    +   + +LPF GG R C G Q A
Sbjct:  325 TTASGISWILYALATHPKHQERCREEIHGLLGD---GASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFA 463          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP39A_MOUSE (24-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp39a1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 49/159 (30.82%), Postives = 81/159 (50.94%), Query Frame = 1
Query:   25 TFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLED-MKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE-SVPPYVYL----PFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINP 483
            T   +  HPD +  +L+   ++       +I   ED +KK+        ES+RL  P   + RK V  ++    T+P G  ++ + F  H NP+YF +P SF P R++E ++  Y++L     FGGG   C G   A L I + +  V+ +Y+ SL++P
Sbjct:  286 TLGYILSHPDIHRTVLESISSVFGTAGKDKIKVSEDDLKKLLIIKWCILESVRLRAPGVIT-RKVVKPVKILNHTVPSGDLLMLSPFWLHRNPKYFPEPESFKPERWKEANLDKYIFLDYFMAFGGGKFQCPGRWFALLEIQLCIILVLYKYECSLLDP 443          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C7D95_MENSP (Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 37/132 (28.03%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  124 LEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            ++D++++KY   V +E+MR+ PPI    R    + E  G+ IP   +++   +    NP Y+E P +F P RF++    ++     ++PFG G R+C G      N+ + +  ++  +DW L    +   MD
Sbjct:  340 VDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECEVNGYKIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFMGSDFEFIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMD 471          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C7D95_MENGR (Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 37/132 (28.03%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  124 LEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV-----YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD 504
            ++D++++KY   V +E+MR+ PPI    R    + E  G+ IP   +++   +    NP Y+E P +F P RF++    ++     ++PFG G R+C G      N+ + +  ++  +DW L    +   MD
Sbjct:  340 VDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECEVNGYKIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFMGSDFEFIPFGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMD 471          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C6A14_DROME (Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 49/166 (29.52%), Postives = 80/166 (48.19%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD--IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN 480
            T+S  +++    LA  PD    L +E  +++ N   GE L  + + ++ Y  QV  E++R  P +    R+   D  I      + KG   L      H +PE + +P  FDP RF+    ++  P  YLPFG GPR C G +  K+   I +  ++ R+ +S+ N
Sbjct:  317 TSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGE-LNYDVLAQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSN 481          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C49A1_DROME (Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 43/167 (25.75%), Postives = 79/167 (47.31%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF-------------EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TTS A + T   LA++PD    L  E   +  ++ A   +    ++++ Y     +E++R+ P +  + R   SD    G+ +PKG  V++      ++P YF +P  F P R+              + + P+V LPFG G R+C G + A++ +   +  +  +Y
Sbjct:  393 TTSVAASSTIYQLAKNPDKQKKLFDELQKVFPHREAD--INQNVLEQMPYLRACVKETLRMRPVVIANGRSLQSDAVINGYHVPKGTHVIFPHLVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHANQKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKY 557          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C6A23_DROME8.913e-1329.27Probable cytochrome P450 6a23 OS=Drosophila melano... [more]
C27C1_HUMAN8.913e-1326.34Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE... [more]
CP52F_CANTR1.164e-1230.43Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP5... [more]
CP4F3_RAT1.164e-1228.93Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus nor... [more]
CP4AM_HUMAN1.164e-1230.99Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE... [more]
CP39A_MOUSE1.164e-1230.8224-hydroxycholesterol 7-alpha-hydroxylase OS=Mus m... [more]
C7D95_MENSP1.164e-1228.03Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D9... [more]
C7D95_MENGR1.164e-1228.03Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D... [more]
C6A14_DROME1.164e-1229.52Probable cytochrome P450 6a14 OS=Drosophila melano... [more]
C49A1_DROME1.164e-1225.75Probable cytochrome P450 49a1 OS=Drosophila melano... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top