BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: TRI4_FUSSP (Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 50/171 (29.24%), Postives = 82/171 (47.95%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLF-PPIFGSFRKAVSD-IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLP-FGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNES 492
            TTS  +A+TF  L  HP+C   L +E  ++   K  G+   L  ++ + Y   V  E  RL   PI  S R A  + ++Y+   IP G  V  + +  H++P+ F +P  F P R+    E+ +P   Y+  F  G R C GY +A   + + +  +   YD  L +  ++
Sbjct:  318 TTSRTLAITFFYLLTHPECLRKLREELNSLP--KVEGDRFPLATLENLPYLNGVVHEGFRLACGPISRSGRVATQENLKYKEHVIPAGTPVSQSTYFMHTDPKIFPEPEKFKPERWIEAAEKKIPLKKYITNFSQGSRQCIGYTMAFAEMYLAMSRIARAYDVELYDTTKA 486          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6W1_DROME (Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 44/153 (28.76%), Postives = 74/153 (48.37%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTI--------PKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKL 423
            T++  + MT   LA++      L QE V+   ++   + ++ E ++++ Y  QV  E++R +P +    R+     E E FT+        P G  +  +    H +P+Y+ DP  +DP RF  S    +    Y+PFG GPR C G +L  L
Sbjct:  309 TSASTMTMTLYELAKNEALQDRLRQEIVDFFGDE---DHISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLL 458          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6U1_DROME (Probable cytochrome P450 6u1 OS=Drosophila melanogaster GN=Cyp6u1 PE=2 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 47/146 (32.19%), Postives = 72/146 (49.32%), Query Frame = 1
Query:   16 IAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIII 435
            +A     LA+ P+       E +N    +  G++ T E +++++YT QV  E++RL  P     R+A  + E  G  F I KG  VL      H +P  +E+P  F P RFEE    S P   +LPFG G R C   + A+  +++
Sbjct:  299 LAFCLYELARQPEVQDRTRLE-INKALEEHGGQV-TPECLRELRYTKQVLNETLRLHTPHPFLLRRATKEFEVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERFEEQARRSRPAAAFLPFGDGLRGCIAARFAEQQLLV 442          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6K1_BLAGE (Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 48/200 (24.00%), Postives = 84/200 (42.00%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEG--FTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPKL*TTSNTAGI 582
            T +  ++ T   L+  PD  + L  E   +M         T ED+  + Y   V  E++R +PP+    R  + D +  G    I +   V     G H +P+Y+ +P  +DP RF E        Y YLPFG GP  C G +   + +   + +++  ++               P     +P+++S +    + T+GI
Sbjct:  328 TNATTLSFTLYELSLQPDLQNRLRSEIAGVMKTSNGKP--TYEDVFGMPYLHMVVSETLRKYPPLPLLDRVCLQDYKVPGTDLIIERDTPVFIALLGLHRDPQYYPNPERYDPERFSEENKRQRKAYTYLPFGEGPHNCIGLRFGYMAVKTALVHMLAEFEVK-------------PCKDTPIPLELSTRSSVLATTSGI 512          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2U1_BOVIN (Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 51/186 (27.42%), Postives = 86/186 (46.24%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD-IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNES---------ITMDPLPF 516
            TT+ ++      ++ HP+    + +E   ++   RA    +L D  ++ YT     E  RL   +  S     S+    +GFTIPKG  +L   +  H +P  +E P  F P RF +     +    ++PFG G R+C G QLAK+   +F+ +V     ++ + P +S         +T+ P PF
Sbjct:  356 TTTNSLLWCLLYMSLHPNIQEKIHEEIARVIGADRAP---SLTDKAQMPYTEATIMEVQRLSTVVPLSIPHMTSEKTVLQGFTIPKGTIILPNLWSVHRDPAIWEKPNDFYPDRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKME--LFLMFVSLMQSFTFVLPKDSKPILTGKYGLTLAPHPF 536          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2D6_PANTR (Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 45/163 (27.61%), Postives = 72/163 (44.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  +A    ++  HPD    + QE  +++   R  E   + D  ++ YT  V  E  R    +  G       DIE +GF IPKG  +         +   +E P  F P  F ++    V P  +LPF  G R C G  LA++ + +F   ++  + +S+
Sbjct:  309 TTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPE---MGDQARMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDKAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSV 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2D6_PANPA (Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 45/163 (27.61%), Postives = 72/163 (44.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSL 474
            TTS  +A    ++  HPD    + QE  +++   R  E   + D  ++ YT  V  E  R    +  G       DIE +GF IPKG  +         +   +E P  F P  F ++    V P  +LPF  G R C G  LA++ + +F   ++  + +S+
Sbjct:  309 TTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPE---MGDQARMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLFTNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSV 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2AC_MOUSE (Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 47/179 (26.26%), Postives = 78/179 (43.58%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRL--FPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE------SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLP 513
            T S  +   F +L +HPD  + + +E   ++   R  +    ED  K+ YT  V  E  R   F P+ G  R+   +  + GF +PK  +V        ++P++F  P  F+P+ F +       +P   +LPF  G R C G  LAK+ +      ++  + +      E I   P P
Sbjct:  303 TVSSTLRYGFLLLMKHPDVEAKVHEEIDRVIGRNRQPQY---EDHMKMPYTQAVINEIQRFSNFAPL-GIPRRITKNTSFRGFFLPKATEVFPILGSLMTDPKFFSSPKDFNPQHFLDDKGQLKKIP--AFLPFSTGKRFCLGDSLAKMELFFLFTTILQNFRFKFPRKLEDINESPTP 475          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP2A3_RAT (Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 43/174 (24.71%), Postives = 79/174 (45.40%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPY----VYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDP 507
            T S  +   F +L +HPD  + + +E   ++   R  +    ED  K+ YT  V  E  R    I  G  R+   D ++  F +PKG +V         +P++F +P  F+P+ F +    +     ++PF  G R C G  LA++ + +F+  ++  + +      + I + P
Sbjct:  305 TVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQAKY---EDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFREFLLPKGTEVFPMLGSVLKDPKFFSNPNDFNPKHFLDDKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFCFKSPQAPQDIDVSP 475          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP19A_CANFA (Cytochrome P450 19A1 OS=Canis familiaris GN=CYP19A1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T S ++     ++A+HP     +++E   ++  +     + ++DM+K+K       ESMR  P +    RKA+ D   +G+ + KG  ++    G     E+F  P  F    F ++VP   + PFG GPR CAG  +A + + + +  ++ R+
Sbjct:  310 TMSVSVFFMLFLIAKHPKVEESIMKEIQAVVGERD----IRIDDMQKLKVVENFIYESMRYQPVVNLVMRKALQDDIIDGYLVKKGTNIILN-IGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLRRF 458          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
TRI4_FUSSP6.388e-1129.24Trichodiene oxygenase OS=Fusarium sporotrichioides... [more]
CP6W1_DROME6.388e-1128.76Probable cytochrome P450 6w1 OS=Drosophila melanog... [more]
CP6U1_DROME6.388e-1132.19Probable cytochrome P450 6u1 OS=Drosophila melanog... [more]
CP6K1_BLAGE6.388e-1124.00Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6... [more]
CP2U1_BOVIN6.388e-1127.42Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 S... [more]
CP2D6_PANTR6.388e-1127.61Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 P... [more]
CP2D6_PANPA6.388e-1127.61Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3... [more]
CP2AC_MOUSE6.388e-1126.26Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE... [more]
CP2A3_RAT6.388e-1124.71Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3... [more]
CP19A_CANFA6.388e-1126.62Cytochrome P450 19A1 OS=Canis familiaris GN=CYP19A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top