BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C6A13_DROME (Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.583e-15
Identity = 54/185 (29.19%), Postives = 91/185 (49.19%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD--IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPI 537
            T+S  ++     LA +PD    L  E + ++  KR  + LT + ++++ Y  QV  E++R +P +    R++  +  I      +  G K++      H +PE + DP  FDP RFE    ++  P+ YLPFG GPR C G +  KL + + + Y++  + +S        T  PL F S+   I
Sbjct:  299 TSSTTMSFCLYELALNPDVQERLRVEVLAVL--KRNNQKLTYDSVQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFS----RSEKTQIPLKFSSRNFLI 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP9F2_DROME (Probable cytochrome P450 9f2 OS=Drosophila melanogaster GN=Cyp9f2 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.292e-15
Identity = 58/193 (30.05%), Postives = 91/193 (47.15%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYE----GFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN----PNESITMDPLPFPSQGMPIKI 543
            T++  +  T   L ++ D    L +E V  ++    G+ LT E +  +KY  QV  E +R +P      R+   DI ++       + KG  +     G H +P+YFE+P+ FDP RF    +ES+ P+ Y PFG G R C G + A L     ++Y++  Y ++       P E IT      P  G  IK+
Sbjct:  321 TSAVLMCFTAHELMENQDVQQRLYEE-VQQVDQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFAPAKKSCIPLELITSGFQLSPKGGFWIKL 512          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6D5_DROME (Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.292e-15
Identity = 56/193 (29.02%), Postives = 91/193 (47.15%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV---YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMD----PLPFPSQGMPIKISPK 552
            TT+   + T   L Q+P+      +E V     K  G+ LT + +  +KY      E+ R +P  P+          +      I KG  ++ +  G H + EYF DPL++ P R+ E+   Y    YLPFG GPR+C G ++ K+N+ I +  V++ +D  +      I       PL  P  G+P+++S K
Sbjct:  318 TTASTTSFTLYELTQNPEVMEKA-KEDVRSAIEKHGGK-LTYDAISDMKYLEACILETARKYPALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIGMHRDEEYFPDPLAYKPERYLENGKDYTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEIRKEKCEIEFGVYGIPL-MPKSGVPVRLSLK 507          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4V2_PONAB (Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.292e-15
Identity = 45/143 (31.47%), Postives = 73/143 (51.05%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLA 417
            TT+ AI  +  +L  +P+    +  E  ++    ++    T+ED+KK++Y   V +E++RLFP +    R    D E  G+ + KG + +   +  H +P YF +P  F P RF     +   PY Y+PF  GPR C G + A
Sbjct:  333 TTAAAINWSLYLLGCNPEVQQKVDHELDDVFG--KSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFA 473          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F5_RAT (Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.292e-15
Identity = 49/159 (30.82%), Postives = 78/159 (49.06%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+ A++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP     R+   DI   +G  IPKG   + + FG H NP  + DP  FDP RF+    +   P  ++PF  GPR C G   A   + + V   + R+
Sbjct:  334 TTASALSWILYNLARHPEYQERCRQEVWELLRDREPEEI-EWDDLAQLPFLTMCIKESLRLHPPAIDLLRRCTQDIVLPDGRVIPKGNICVISIFGIHHNPSVWPDPEVFDPFRFDSENRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVVVALTLLRF 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4E2_DROME (Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 7.292e-15
Identity = 47/158 (29.75%), Postives = 77/158 (48.73%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  ++    +L++H D    L +E   +M N   G   T +++ ++KY     +E+ R++P  P  G F +   D   +G  +PKG  +         N + F+DP  F P RFE   P P+ Y+PF  GPR C G + A L I   V  ++  ++
Sbjct:  311 TTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTE--KDYVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFE 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4F3_HUMAN (Leukotriene-B(4) omega-hydroxylase 2 OS=Homo sapiens GN=CYP4F3 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 9.523e-15
Identity = 47/152 (30.92%), Postives = 79/152 (51.97%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE----ESVPPYVYLPFGGGPRLCAG--YQLAKLNIII 435
            TT+  ++     LA+HP+      QE   ++ ++   EI   +D+ ++ +     +ES+RL PP+    R    DI   +G  IPKG   L + FGTH NP  + DP  +DP RF+    +   P  ++PF  GPR C G  + +A++ +++
Sbjct:  332 TTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEI-EWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4E1_DROME (Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.244e-14
Identity = 46/158 (29.11%), Postives = 74/158 (46.84%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP-PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  +     +L++HPD    L  E  ++M     G   T +++  +K+     +E+ RL+P  P  G F +   D   +G  +PKG  +         N   F+DP  F P RF+   P P+ Y+PF  GPR C G + A L I   V  ++  ++
Sbjct:  311 TTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKHLDLFIKEAQRLYPSVPFIGRFTE--KDYVIDGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQPERFDREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFE 466          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4AA1_DROME (Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.244e-14
Identity = 45/154 (29.22%), Postives = 72/154 (46.75%), Query Frame = 1
Query:   13 AIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            A+A T  +L Q+P+C    + E   I  +      +T  D+ +++Y     +E++RL+P +    RK   ++     T+P G  V    + TH     + DP  F P RF     E+  PY +LPF  GPR C G + A + I   V  ++  Y
Sbjct:  320 AVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMT--DLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIYPDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSY 471          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP6D4_DROME (Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.624e-14
Identity = 48/168 (28.57%), Postives = 89/168 (52.98%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSD--IEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE---SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE 489
            TT    A T   LAQ+P+    L Q+ V+    K  G+I T + + K+++     +E++R +P +    R+   D  +      IPKG  V+ + +G H + EYF DP ++DP RF E   +  P  ++PFG GPR+C   ++ ++N  + +  ++  ++  +++ +E
Sbjct:  322 TTGSTAAFTIYELAQYPELLKRL-QDEVDETLAKNDGKI-TYDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEVMSRSE 487          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C6A13_DROME5.583e-1529.19Probable cytochrome P450 6a13 OS=Drosophila melano... [more]
CP9F2_DROME7.292e-1530.05Probable cytochrome P450 9f2 OS=Drosophila melanog... [more]
CP6D5_DROME7.292e-1529.02Probable cytochrome P450 6d5 OS=Drosophila melanog... [more]
CP4V2_PONAB7.292e-1531.47Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2... [more]
CP4F5_RAT7.292e-1530.82Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5... [more]
CP4E2_DROME7.292e-1529.75Cytochrome P450 4e2 OS=Drosophila melanogaster GN=... [more]
CP4F3_HUMAN9.523e-1530.92Leukotriene-B(4) omega-hydroxylase 2 OS=Homo sapie... [more]
CP4E1_DROME1.244e-1429.11Probable cytochrome P450 4e1 OS=Drosophila melanog... [more]
C4AA1_DROME1.244e-1429.22Probable cytochrome P450 4aa1 OS=Drosophila melano... [more]
CP6D4_DROME1.624e-1428.57Probable cytochrome P450 6d4 OS=Drosophila melanog... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top