BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOC_MOUSE (Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 7.322e-39
Identity = 78/167 (46.71%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR D+    +       P+ + +G ++   I A  Y+ECS+KT++ V+ VF+ A +  LQ  KN +++
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOC_HUMAN (Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 7.322e-39
Identity = 78/167 (46.71%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR D+    +       P+ + +G ++   I A  Y+ECS+KT++ V+ VF+ A +  LQ  KN +++
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOC_BOVIN (Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 7.322e-39
Identity = 78/167 (46.71%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR D+    +       P+ + +G ++   I A  Y+ECS+KT++ V+ VF+ A +  LQ  KN +++
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_DROME (Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 9.562e-39
Identity = 78/167 (46.71%), Postives = 109/167 (65.27%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE++H+ P VPIILVG K DLR+D   + D       P+   +G  + + I A  Y+ECS+K+++ V+ VF+ A +  LQ  K  K +
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO_APLCA (Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.249e-38
Identity = 81/169 (47.93%), Postives = 110/169 (65.09%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW PE+RH+ P VPIILVG K DLR+D+    +       P+    G  + + I A  Y+ECS+KT++ V+ VF+ A +  LQ     KKKK+
Sbjct:   22 LIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKKDLRNDESTKRELMKMKQEPVRPEDGRAMAEKINAYSYLECSAKTKEGVRDVFETATRAALQ----VKKKKK 186          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_ASHGO (GTP-binding protein RHO1 OS=Ashbya gossypii GN=RHO1 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.249e-38
Identity = 86/176 (48.86%), Postives = 113/176 (64.20%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL------QPPKNTKKKKRR 608
            +I +    FP  YVPTVFDN+ A+V VDG  V L LWDTAGQEDY+RLRPLSY  ++V L+ +S+    S ENV +KWI E+ ++  GVPIILVG K DLR+D Q +      G  P++ AQ +E+   IGA  YIECS+KT   V+ VF+AA +  L         K+ KKKK++
Sbjct:   28 LIVFAKGKFPQVYVPTVFDNYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFCQGVPIILVGCKADLRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGVREVFEAATRASLMGKQGKSKAKSDKKKKKK 203          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_SCHPO (GTP-binding protein rho1 OS=Schizosaccharomyces pombe GN=rho1 PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.782e-38
Identity = 80/176 (45.45%), Postives = 115/176 (65.34%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL-------QPPKNTKKKKR 605
            +I ++  TFP  YVPTVF+N+ A+V VDG  V L LWDTAGQEDY+RLRPLSY  + V L+ F++ S  S +NV +KWI E+ H+   +PI+LV  K DLR+D + + +       P+TT +G+ + + IGA  Y+ECS+KT + V+ VF++A +  +       +P   TKKKKR
Sbjct:   23 LIVFSKGTFPEVYVPTVFENYVADVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSSLPILLVACKADLRNDPKIIEELSKTNQHPVTTEEGQAVAQKIGAYKYLECSAKTNEGVREVFESATRAAMLKHKPKVKPSSGTKKKKR 198          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RACD_DICDI (Rho-related protein racD OS=Dictyostelium discoideum GN=racD PE=2 SV=3)

HSP 1 Score: 156.762 bits (395), Expect = 8.095e-38
Identity = 79/168 (47.02%), Postives = 105/168 (62.50%), Query Frame = 3
Query:   93 RLACVISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLA--DHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNT 590
            + + +I YT+  FP DYVPTVFDNF+   + D   VNL LWDTAGQEDY+ LRPLSY   DVF++ +S++ + S +N+  KW+PE+     G PIILVGTK DLR+DK+ L+        P++  +G  L K IGA  + ECS+ T   V  +F AAIK     P  T
Sbjct:   21 KTSLLILYTTKAFPKDYVPTVFDNFNCLEMYDNKPVNLVLWDTAGQEDYDNLRPLSYPQTDVFIICYSVVKRDSLDNIKYKWLPEINQTNQGTPIILVGTKTDLREDKKTLSQLQESKQEPVSRDEGVALAKEIGAVQFFECSALTGNGVNDIFAAAIKAAFNKPAVT 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOB_RAT (Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.355e-37
Identity = 76/159 (47.80%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW+PE++H+ P VPIILV  K DLR D+    +       P+ T  G  +   I A  Y+ECS+KT++ V+ VF+ A +  LQ
Sbjct:   22 LIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ 180          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHOB_MOUSE (Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.355e-37
Identity = 76/159 (47.80%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQ 575
            +I ++ + FP  YVPTVF+N+ A++ VDG  V L LWDTAGQEDY+RLRPLSY   DV L+ FS+ S  S EN+ +KW+PE++H+ P VPIILV  K DLR D+    +       P+ T  G  +   I A  Y+ECS+KT++ V+ VF+ A +  LQ
Sbjct:   22 LIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ 180          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RHOC_MOUSE7.322e-3946.71Rho-related GTP-binding protein RhoC OS=Mus muscul... [more]
RHOC_HUMAN7.322e-3946.71Rho-related GTP-binding protein RhoC OS=Homo sapie... [more]
RHOC_BOVIN7.322e-3946.71Rho-related GTP-binding protein RhoC OS=Bos taurus... [more]
RHO1_DROME9.562e-3946.71Ras-like GTP-binding protein Rho1 OS=Drosophila me... [more]
RHO_APLCA1.249e-3847.93Ras-like GTP-binding protein RHO OS=Aplysia califo... [more]
RHO1_ASHGO1.249e-3848.86GTP-binding protein RHO1 OS=Ashbya gossypii GN=RHO... [more]
RHO1_SCHPO2.782e-3845.45GTP-binding protein rho1 OS=Schizosaccharomyces po... [more]
RACD_DICDI8.095e-3847.02Rho-related protein racD OS=Dictyostelium discoide... [more]
RHOB_RAT2.355e-3747.80Rho-related GTP-binding protein RhoB OS=Rattus nor... [more]
RHOB_MOUSE2.355e-3747.80Rho-related GTP-binding protein RhoB OS=Mus muscul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top