BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC3_HUMAN (Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.438e-56
Identity = 104/170 (61.18%), Postives = 127/170 (74.71%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDK---QFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S AS+ENV  KW PE+RH+ P  PI+LVGTKLDLRDDK   + L D   A PIT  QG  + + IG+  Y+ECS+ TQ+ +K VFD AI+ VL PP   K  K+
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLA-PITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.438e-56
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_HUMAN (Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 3.187e-56
Identity = 101/168 (60.12%), Postives = 122/168 (72.62%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP +Y+PTVFDN+SANV+VD   VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S ASYENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  L K I +  Y+ECS+ TQ+ +K VFD AI+ VL P    ++K+
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKR 187          

HSP 2 Score: 35.039 bits (79), Expect = 3.187e-56
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_MOUSE (Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 4.154e-56
Identity = 101/168 (60.12%), Postives = 122/168 (72.62%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP +Y+PTVFDN+SANV+VD   VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S ASYENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  L K I +  Y+ECS+ TQ+ +K VFD AI+ VL P    ++K+
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKR 187          

HSP 2 Score: 35.039 bits (79), Expect = 4.154e-56
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_DROME (Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 4.154e-56
Identity = 100/169 (59.17%), Postives = 123/169 (72.78%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLAD--HPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VD   +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL++ AS+ENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  + K IGA  Y+ECS+ TQ+ +K VFD AI+ VL P    K K++
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRK 188          

HSP 2 Score: 35.039 bits (79), Expect = 4.154e-56
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_BOVIN (Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 5.416e-56
Identity = 101/168 (60.12%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP +Y+PTVFDN+SANV+VD   VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S ASYENV  KW PE+RH+ P  PIILVGTKLDLRDDK  +         PIT  QG  L K I +  Y+ECS+ TQ+ +K VFD AI+ VL P     +K+
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRPQKR 187          

HSP 2 Score: 35.039 bits (79), Expect = 5.416e-56
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1A_DICDI (Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 1.200e-55
Identity = 100/167 (59.88%), Postives = 124/167 (74.25%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDK--QFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKK 599
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FS+IS +S+ENV  KW PE+ H+AP VPIILVGTKLD+R+DK  Q         PI+  QG    K I A  Y+ECS+ TQ+ +K VFD AI+ V+ PP + KKK
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIISPSSFENVNGKWHPEICHHAPNVPIILVGTKLDMREDKETQDRLKEKKLYPISYEQGLAKMKEINAVKYLECSALTQKGLKTVFDEAIRAVINPPLSKKKK 186          

HSP 2 Score: 35.039 bits (79), Expect = 1.200e-55
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_DROME (Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.200e-55
Identity = 100/169 (59.17%), Postives = 123/169 (72.78%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYT+N FP +Y+PTVFDN+SANV+VD   +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL++ AS+ENV  KW PE+RH+ P VPIILVGTKLDLRDDKQ +         PIT  QG  + K I A  Y+ECS+ TQ+ +K VFD AI+ VL P     K+ +
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.200e-55
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC2_CAVPO (Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 1.305e-54
Identity = 98/168 (58.33%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFL--ADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP +Y+PTVFDN+SANV+VD   VNLGLWDTAGQEDY+RLRPLSY   DVFL+ FSL+S ASYENV   W P++RH+ P  PIIL+GTKLDLRDDK+ +         PIT  QG  L K I +  Y+ECS+ TQ+ +K VFD AI+ VL P     +K+
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVHANWYPKVRHHCPSTPIILLGTKLDLRDDKETIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRPQKR 187          

HSP 2 Score: 35.039 bits (79), Expect = 1.305e-54
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1C_DICDI (Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 1.702e-54
Identity = 98/168 (58.33%), Postives = 123/168 (73.21%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDK--QFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FS+IS +SYENV+ KW PE+ H+AP VPIILVGTK+D+R+DK  Q         P++  QG    K I A  Y+ECS+ TQ+ +K VFD AI+ V+ PP    K K
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIISPSSYENVSGKWGPEVFHHAPNVPIILVGTKMDMREDKETQDRLKEKKLYPVSYEQGLLKMKEINAFKYLECSALTQKGLKTVFDEAIRSVINPPVKKSKSK 187          

HSP 2 Score: 35.039 bits (79), Expect = 1.702e-54
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1B_DICDI (Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 1.089e-53
Identity = 96/170 (56.47%), Postives = 122/170 (71.76%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDK--QFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYT+N FP +Y+PTVFDN+SANV+VDG  +NLGLWDTAGQEDY+RLRPLSY   DVFL+ FS++S AS+ENV  KW PE+ H+AP VPIILVGTKLD+R+D+  Q         P++  QG    K I A  Y+ECS+ TQ+ +K VFD AI+ V+ P    K K  +
Sbjct:   20 LISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPASFENVNGKWHPEICHHAPNVPIILVGTKLDMREDRDTQDRLKEKKLYPVSYEQGLSKMKEINAVKYLECSALTQKGLKTVFDEAIRSVINPTLKKKPKSSK 189          

HSP 2 Score: 35.039 bits (79), Expect = 1.089e-53
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   56 IKCVTVGDGAVGKTCM 103
            IKCV VGDGAVGKTC+
Sbjct:    4 IKCVVVGDGAVGKTCL 19          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAC3_HUMAN1.438e-5661.18Ras-related C3 botulinum toxin substrate 3 OS=Homo... [more]
RAC2_HUMAN3.187e-5660.12Ras-related C3 botulinum toxin substrate 2 OS=Homo... [more]
RAC2_MOUSE4.154e-5660.12Ras-related C3 botulinum toxin substrate 2 OS=Mus ... [more]
RAC1_DROME4.154e-5659.17Ras-related protein Rac1 OS=Drosophila melanogaste... [more]
RAC2_BOVIN5.416e-5660.12Ras-related C3 botulinum toxin substrate 2 OS=Bos ... [more]
RAC1A_DICDI1.200e-5559.88Rho-related protein rac1A OS=Dictyostelium discoid... [more]
RAC2_DROME1.200e-5559.17Ras-related protein Rac2 OS=Drosophila melanogaste... [more]
RAC2_CAVPO1.305e-5458.33Ras-related C3 botulinum toxin substrate 2 OS=Cavi... [more]
RAC1C_DICDI1.702e-5458.33Rho-related protein rac1C OS=Dictyostelium discoid... [more]
RAC1B_DICDI1.089e-5356.47Rho-related protein rac1B OS=Dictyostelium discoid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top