BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_SHIF8 (Chaperone protein dnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V   A E EIR  Y RLA+K+HPD+ +    A ++F+EI EAY+VL+D  KR  YD  G
Sbjct:    4 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PSEST (Chaperone protein dnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V+  A+E E++  Y RLA+K HPD+      A   F+E NEAY+VLSDP KR  YD  G
Sbjct:    4 RDFYEVLGVERGASEAELKKAYRRLAMKHHPDRNPGDKAAEEAFKEANEAYEVLSDPSKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PHOLL (Chaperone protein dnaJ OS=Photorhabdus luminescens subsp. laumondii GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 31/67 (46.27%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V   A+E+EI+  Y RLA+K+HPD+ +    A S+F+E+ EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGVSKTASEKEIKKAYKRLAMKYHPDRNQGDKEAESQFKEVKEAYEILTDDQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_NITEU (Chaperone protein dnaJ OS=Nitrosomonas europaea GN=dnaJ PE=3 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY++L V  DA E E++  Y +LA+K+HPD+      A  RF+ I EAY++LSDP KR  YD  G
Sbjct:    5 DYYEVLGVGRDADENELKKAYRKLAMKYHPDRNAGDTKAEERFKNIKEAYEILSDPNKRAAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_MARAV (Chaperone protein dnaJ OS=Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 30/67 (44.78%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L +  DA E+EI+  Y +LA+K+HPD+  D   A ++F+E +EAY++L+D  KR  YD  G
Sbjct:    4 RDYYEVLGISRDADEKEIKRAYRKLAMKYHPDRNPDDKDAETKFKEASEAYEILADSSKRAAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LEPBP (Chaperone protein dnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + YY++L V   A+++EI+S Y +LA+K+HPDK K    A  +F+E  EAY+VL DP KR+ YD  G
Sbjct:    4 RGYYEVLGVSKGASDDEIKSAYRKLAIKYHPDKNKGDKEAEEKFKEATEAYEVLRDPQKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LEPBA (Chaperone protein dnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + YY++L V   A+++EI+S Y +LA+K+HPDK K    A  +F+E  EAY+VL DP KR+ YD  G
Sbjct:    4 RGYYEVLGVSKGASDDEIKSAYRKLAIKYHPDKNKGDKEAEEKFKEATEAYEVLRDPQKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_LARHH (Chaperone protein dnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 30/67 (44.78%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KD+Y +L V+ DA++++I+  Y +LA+K+HPD+  D   A  +F+E  EAY++LSD  KR  YD  G
Sbjct:    4 KDFYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPDSKDAEEKFKEAKEAYEILSDAQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_HAEIN (Chaperone protein dnaJ OS=Haemophilus influenzae GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 34/67 (50.75%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L +   A+E+EI+  Y RLA K HPDK +    A  +F+EINEAY+VL D  KR  YD  G
Sbjct:    4 KDYYEVLGLQKGASEDEIKRAYKRLASKHHPDKNQGSKEAEEKFKEINEAYEVLGDDQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_FUSNP (Chaperone protein dnaJ OS=Fusobacterium nucleatum subsp. polymorphum GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDK-----QKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L VD +A+E +I+  Y + A+K+HPDK       ++  A  +F+EINEAYQVLSD  K+++YD  G
Sbjct:    4 RDYYEVLGVDKNASENDIKKAYRKAAMKYHPDKFANATDAEKKDAEEKFKEINEAYQVLSDNEKKQQYDQFG 75          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_SHIF81.205e-1150.75Chaperone protein dnaJ OS=Shigella flexneri seroty... [more]
DNAJ_PSEST1.205e-1147.76Chaperone protein dnaJ OS=Pseudomonas stutzeri GN=... [more]
DNAJ_PHOLL1.205e-1146.27Chaperone protein dnaJ OS=Photorhabdus luminescens... [more]
DNAJ_NITEU1.205e-1148.48Chaperone protein dnaJ OS=Nitrosomonas europaea GN... [more]
DNAJ_MARAV1.205e-1144.78Chaperone protein dnaJ OS=Marinobacter aquaeolei (... [more]
DNAJ_LEPBP1.205e-1147.76Chaperone protein dnaJ OS=Leptospira biflexa serov... [more]
DNAJ_LEPBA1.205e-1147.76Chaperone protein dnaJ OS=Leptospira biflexa serov... [more]
DNAJ_LARHH1.205e-1144.78Chaperone protein dnaJ OS=Laribacter hongkongensis... [more]
DNAJ_HAEIN1.205e-1150.75Chaperone protein dnaJ OS=Haemophilus influenzae G... [more]
DNAJ_FUSNP1.205e-1145.83Chaperone protein dnaJ OS=Fusobacterium nucleatum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top