BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ECOLI (Chaperone protein dnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V   A E EIR  Y RLA+K+HPD+ +    A ++F+EI EAY+VL+D  KR  YD  G
Sbjct:    4 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ECODH (Chaperone protein dnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V   A E EIR  Y RLA+K+HPD+ +    A ++F+EI EAY+VL+D  KR  YD  G
Sbjct:    4 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ECOBW (Chaperone protein dnaJ OS=Escherichia coli (strain K12 / BW2952) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V   A E EIR  Y RLA+K+HPD+ +    A ++F+EI EAY+VL+D  KR  YD  G
Sbjct:    4 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOD6 (Chaperone protein dnaJ OS=Clostridium difficile (strain 630) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            ++  +DYY++L +   A  +EI+  Y +LA+K+HPD+      A  +F+EINEAY+VLSD  KR+ YD  G
Sbjct:    1 MSTKRDYYEVLGISKGAEAQEIKKAYRKLAMKYHPDRNPGDKEAEEKFKEINEAYEVLSDDTKRKTYDQFG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOCE (Chaperone protein dnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A  +DYY++L VD +A++ E++  Y  LA K+HPD       A ++F+E+NEAY++LSD  KR  YD  G
Sbjct:    1 MADKRDYYEVLGVDKNASDAELKKAYRNLAKKYHPDVNPGDTTAEAKFKEVNEAYEILSDSQKRSRYDQFG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BLOPB (Chaperone protein dnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.205e-11
Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY+IL +  +A E EI+ +Y RLA+K+HPD+      A ++F+EI EAY+VLS+  KR  YD  G
Sbjct:    5 DYYEILGISKNADEREIKKSYKRLAMKFHPDRNPGNTTAETKFKEIKEAYEVLSNSEKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: YHXB_SCHPO (Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe GN=SPBC3E7.11c PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.574e-11
Identity = 32/68 (47.06%), Postives = 46/68 (67.65%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDR-DCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY IL +  DA  + I+ +Y RLA+ +HPDK ++  + A  +FQ++ EAYQVLSDP  R +YD  G
Sbjct:    8 RDYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKYDKLG 75          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJC3_DICDI (DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.574e-11
Identity = 34/70 (48.57%), Postives = 47/70 (67.14%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDK--QKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            +AK KDYYKIL +   AT EEI+  + +LA+K HPDK  + D++ A   + +INEAY+ L D  KR+ YD
Sbjct:  385 MAKRKDYYKILGIQKSATPEEIKKAFKKLAIKNHPDKSTETDKEKAQQIYMDINEAYEALKDEEKRKRYD 454          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_VIBF1 (Chaperone protein dnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.574e-11
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V  DA+E +I+  Y RLA+K+HPD+ +  D A  +F+E+  AY++L+D  KR  YD  G
Sbjct:    4 RDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQGDDTAAEKFKEVKVAYEILTDAQKRSAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_TOLAT (Chaperone protein dnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.574e-11
Identity = 32/67 (47.76%), Postives = 44/67 (65.67%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V+  A E EI+  Y RLA+K+HPD+  D   +  +F+E  EAY++LSD  KR  YD  G
Sbjct:    4 RDYYEILGVERSADEREIKKAYKRLAMKFHPDRNPDNPESEEKFKEAKEAYEILSDAQKRAAYDKFG 70          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_ECOLI1.205e-1150.75Chaperone protein dnaJ OS=Escherichia coli (strain... [more]
DNAJ_ECODH1.205e-1150.75Chaperone protein dnaJ OS=Escherichia coli (strain... [more]
DNAJ_ECOBW1.205e-1150.75Chaperone protein dnaJ OS=Escherichia coli (strain... [more]
DNAJ_CLOD61.205e-1143.66Chaperone protein dnaJ OS=Clostridium difficile (s... [more]
DNAJ_CLOCE1.205e-1143.66Chaperone protein dnaJ OS=Clostridium cellulolytic... [more]
DNAJ_BLOPB1.205e-1148.48Chaperone protein dnaJ OS=Blochmannia pennsylvanic... [more]
YHXB_SCHPO1.574e-1147.06Uncharacterized J domain-containing protein C3E7.1... [more]
DNJC3_DICDI1.574e-1148.57DnaJ homolog subfamily C member 3 homolog OS=Dicty... [more]
DNAJ_VIBF11.574e-1143.28Chaperone protein dnaJ OS=Vibrio fischeri (strain ... [more]
DNAJ_TOLAT1.574e-1147.76Chaperone protein dnaJ OS=Tolumonas auensis (strai... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top