BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BURCA (Chaperone protein dnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-11
Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  +A+++EI+  Y +LA+K+HPD+  D   A   F+E  EAY++LSD  KR  YD  G
Sbjct:    4 RDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BURA4 (Chaperone protein dnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-11
Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V  +A+++EI+  Y +LA+K+HPD+  D   A   F+E  EAY++LSD  KR  YD  G
Sbjct:    4 RDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDSKDAEEHFKEAKEAYEMLSDGQKRAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_BACWK (Chaperone protein dnaJ OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-11
Identity = 31/67 (46.27%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L +   A+++EI+  Y RLA K+HPD  K+ + A  +F+E+ EAY+VLSD  KR +YD  G
Sbjct:    4 RDYYEVLGLSQGASKDEIKKAYRRLAKKYHPDVSKEEN-AIEKFKEVQEAYEVLSDDQKRAQYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ALHEH (Chaperone protein dnaJ OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-11
Identity = 31/66 (46.97%), Postives = 44/66 (66.67%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY+ L V  +A++ EI+  Y R+A+K+HPD+      A +RF+E  EAY++LSDP KR  YD  G
Sbjct:    5 DYYEALGVARNASDSEIKKAYRRMAMKYHPDRNPGDKEAEARFKEAKEAYEILSDPQKRAAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: CBPA_PSESM (Curved DNA-binding protein OS=Pseudomonas syringae pv. tomato GN=cbpA PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-11
Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYKIL+V+  A ++ I++ Y +LA K+HPD  K+   A  +F+E +EAY+VLS P KR EYD
Sbjct:    4 KDYYKILDVEPAADDKAIKTAYRKLARKYHPDVSKEAG-AEDKFKEASEAYEVLSSPEKRAEYD 66          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: CAJ1_YEAST (Protein CAJ1 OS=Saccharomyces cerevisiae GN=CAJ1 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-11
Identity = 33/71 (46.48%), Postives = 44/71 (61.97%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            + K  +YY IL +  +AT  EI+  Y R A++ HPDK  D   A ++FQ + EAYQVLSDP  R +YD  G
Sbjct:    1 MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKYDQFG 71          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_BURCA7.813e-1144.78Chaperone protein dnaJ OS=Burkholderia cenocepacia... [more]
DNAJ_BURA47.813e-1144.78Chaperone protein dnaJ OS=Burkholderia ambifaria (... [more]
DNAJ_BACWK7.813e-1146.27Chaperone protein dnaJ OS=Bacillus weihenstephanen... [more]
DNAJ_ALHEH7.813e-1146.97Chaperone protein dnaJ OS=Alkalilimnicola ehrliche... [more]
CBPA_PSESM7.813e-1151.56Curved DNA-binding protein OS=Pseudomonas syringae... [more]
CAJ1_YEAST7.813e-1146.48Protein CAJ1 OS=Saccharomyces cerevisiae GN=CAJ1 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top