BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLPD (Chaperone protein dnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.860e-12
Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L +   AT++EI+  Y +LA+++HPDK  D   A   F+E+NEAY+ LS+  KRR YD  G
Sbjct:    3 KDYYEVLGLSRSATKDEIKKAYRKLAMQYHPDKNPDNKDAEEHFKEVNEAYEALSNDDKRRRYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLCV (Chaperone protein dnaJ OS=Chlamydophila caviae GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.860e-12
Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY +L V   A+ EEI+ +Y +LA+K+HPDK      A  RF+E++EAY+VLSDP KR  YD  G
Sbjct:    2 DYYDVLGVSKTASPEEIKKSYRKLAVKYHPDKNPGDAEAEKRFKEVSEAYEVLSDPQKRESYDRYG 67          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLAB (Chaperone protein dnaJ OS=Chlamydophila abortus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.860e-12
Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY +L V   A+ EEI+ +Y +LA+K+HPDK      A  RF+E++EAY+VLSDP KR  YD  G
Sbjct:    2 DYYDVLGVSKTASPEEIKKSYRKLAVKYHPDKNPGDAEAEKRFKEVSEAYEVLSDPQKRESYDRYG 67          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJC7_SCHPO (DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe GN=SPBC543.02c PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
Query:  118 AKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDS 321
            +K KD+YKIL V  +AT+ EI+  Y +LAL +HPDK      A +RF+E+ EAY +LSDP  RR +DS
Sbjct:  345 SKRKDHYKILGVSKEATDIEIKKAYRKLALVYHPDKNAGNLEAEARFKEVGEAYTILSDPESRRRFDS 412          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJB4_MOUSE (DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 35/67 (52.24%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY IL +D  AT+E+++  Y + ALK+HPDK K    A  +F+E+ EAY+VLSDP KR  YD  G
Sbjct:    3 KDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKSPQ-AEEKFKEVAEAYEVLSDPKKREIYDQFG 68          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_VIBHB (Chaperone protein dnaJ OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 29/67 (43.28%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V  DA+E +I+  Y RLA+K+HPD+ +  + A  +F+E+ EAY++L+DP K+  YD  G
Sbjct:    4 RDFYEVLGVGRDASERDIKKAYKRLAMKFHPDRNQGDESAADKFKEVKEAYEILTDPQKKAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_THICR (Chaperone protein dnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 33/67 (49.25%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+ILEV   A+E EI+  Y +LA+++HPD+  D + A  +F+E +EAY+VLSD  KR+ YD  G
Sbjct:    4 RDYYEILEVSATASEGEIKKAYRKLAMRYHPDRNPDDEEAEDKFKEASEAYEVLSDAQKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_PSEMY (Chaperone protein dnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L V+  A+E E++  Y RLA+K+HPD+  D   A  +F+E NEAY+VLSD  KR  YD  G
Sbjct:    4 RDYYEVLGVERGASEAELKKAYRRLAMKYHPDRNPDDKGAEEKFKEANEAYEVLSDAGKRSAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_DEIPR (Chaperone protein dnaJ OS=Deinococcus proteolyticus GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L V   A++ +I+S Y +LA ++HPDK    + A  +F+EI EAY VLSDP KR+ YD  G
Sbjct:    4 KDYYEVLGVSRSASDSDIKSAYRKLAKQYHPDKNAGDESAAEKFKEIGEAYAVLSDPQKRQAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOB8 (Chaperone protein dnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 32/67 (47.76%), Postives = 49/67 (73.13%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYY++L +   A+++EI+  + +LA+K+HPD+ +    A  +F+EINEAYQVLSDP K+ +YD  G
Sbjct:    4 KDYYELLGLQKGASDDEIKRAFRKLAVKYHPDRNQGNAEAEEKFKEINEAYQVLSDPEKKAKYDQFG 70          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_CHLPD1.860e-1247.76Chaperone protein dnaJ OS=Chlorobium phaeobacteroi... [more]
DNAJ_CHLCV1.860e-1251.52Chaperone protein dnaJ OS=Chlamydophila caviae GN=... [more]
DNAJ_CHLAB1.860e-1251.52Chaperone protein dnaJ OS=Chlamydophila abortus GN... [more]
DNJC7_SCHPO2.429e-1251.47DnaJ homolog subfamily C member 7 homolog OS=Schiz... [more]
DNJB4_MOUSE2.429e-1252.24DnaJ homolog subfamily B member 4 OS=Mus musculus ... [more]
DNAJ_VIBHB2.429e-1243.28Chaperone protein dnaJ OS=Vibrio harveyi (strain A... [more]
DNAJ_THICR2.429e-1249.25Chaperone protein dnaJ OS=Thiomicrospira crunogena... [more]
DNAJ_PSEMY2.429e-1249.25Chaperone protein dnaJ OS=Pseudomonas mendocina (s... [more]
DNAJ_DEIPR2.429e-1249.25Chaperone protein dnaJ OS=Deinococcus proteolyticu... [more]
DNAJ_CLOB82.429e-1247.76Chaperone protein dnaJ OS=Clostridium beijerinckii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top