BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHRSD (Chaperone protein dnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 31/67 (46.27%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY++L ++  A ++EI+  Y RLA K+HPD+  D D A  +F+E++EAY+VL+D  KR  YD  G
Sbjct:    4 RDYYEVLGIERGADQKEIKKAYRRLAQKYHPDRNPDDDTAAEKFREVSEAYEVLTDEEKRSAYDQFG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CHLPN (Chaperone protein dnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 34/66 (51.52%), Postives = 44/66 (66.67%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            DYY IL +   A+ EEI+  Y +LA+K+HPDK      A  RF+E++EAY+VLSDP KR  YD  G
Sbjct:    2 DYYSILGISKTASAEEIKKAYRKLAVKYHPDKNPGDAAAEKRFKEVSEAYEVLSDPQKRDSYDRFG 67          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: CBPA_PSEE4 (Curved DNA-binding protein OS=Pseudomonas entomophila (strain L48) GN=cbpA PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 36/64 (56.25%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYYKIL V+  A E+ I++ Y +LA K+HPD  K+RD A  +F+E NEAY+VL D  KR EYD
Sbjct:    4 KDYYKILGVEASADEKAIKAAYRKLARKYHPDVSKERD-AEDKFKEANEAYEVLGDKDKRAEYD 66          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJA3_MOUSE (DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.172e-12
Identity = 36/78 (46.15%), Postives = 54/78 (69.23%), Query Frame = 1
Query:   94 NFDFLSLLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +F   + LAK  DYY+IL V  +A++++I+  Y +LA K+HPD  KD   A  +F ++ EAY+VLSD VKR++YD+ G
Sbjct:   82 SFHTSASLAKD-DYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYG 158          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_VIBHA (Chaperone protein dnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.172e-12
Identity = 28/67 (41.79%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +D+Y++L V  DA+E +I+  Y RLA+K+HPD+ +  + A  +F+E+ E+Y++L+DP K+  YD  G
Sbjct:    4 RDFYEVLGVSRDASERDIKKAYKRLAMKYHPDRNQGDESAADKFKEVKESYEILTDPQKKAAYDQYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJC5_RAT (DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  109 SLLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKGMLHIY 342
            SL    +  Y +L +D +AT ++I+ +Y +LALK+HPDK  D   A  +F+EIN A+ +L+D  KR  YD  G L +Y
Sbjct:    8 SLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLY 85          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJC5_MOUSE (DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  109 SLLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKGMLHIY 342
            SL    +  Y +L +D +AT ++I+ +Y +LALK+HPDK  D   A  +F+EIN A+ +L+D  KR  YD  G L +Y
Sbjct:    8 SLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLY 85          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJC5_HUMAN (DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  109 SLLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKGMLHIY 342
            SL    +  Y +L +D +AT ++I+ +Y +LALK+HPDK  D   A  +F+EIN A+ +L+D  KR  YD  G L +Y
Sbjct:    8 SLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLY 85          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJC5_BOVIN (DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  109 SLLAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKGMLHIY 342
            SL    +  Y +L +D +AT ++I+ +Y +LALK+HPDK  D   A  +F+EIN A+ +L+D  KR  YD  G L +Y
Sbjct:    8 SLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLY 85          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNJ6A_XENLA (DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-A PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.143e-12
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  130 DYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKD-RDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +YY++L V  +A+ ++I+  Y RLALKWHPDK  D +D A  RF+E+ EAY+VLSD  KR  YD  G
Sbjct:    3 EYYEVLGVQRNASADDIKKAYRRLALKWHPDKNPDNKDEAERRFKEVAEAYEVLSDSKKRDIYDKYG 69          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_CHRSD2.429e-1246.27Chaperone protein dnaJ OS=Chromohalobacter salexig... [more]
DNAJ_CHLPN2.429e-1251.52Chaperone protein dnaJ OS=Chlamydia pneumoniae GN=... [more]
CBPA_PSEE42.429e-1256.25Curved DNA-binding protein OS=Pseudomonas entomoph... [more]
DNJA3_MOUSE3.172e-1246.15DnaJ homolog subfamily A member 3, mitochondrial O... [more]
DNAJ_VIBHA3.172e-1241.79Chaperone protein dnaJ OS=Vibrio harveyi GN=dnaJ P... [more]
DNJC5_RAT4.143e-1242.31DnaJ homolog subfamily C member 5 OS=Rattus norveg... [more]
DNJC5_MOUSE4.143e-1242.31DnaJ homolog subfamily C member 5 OS=Mus musculus ... [more]
DNJC5_HUMAN4.143e-1242.31DnaJ homolog subfamily C member 5 OS=Homo sapiens ... [more]
DNJC5_BOVIN4.143e-1242.31DnaJ homolog subfamily C member 5 OS=Bos taurus GN... [more]
DNJ6A_XENLA4.143e-1252.24DnaJ homolog subfamily B member 6-A OS=Xenopus lae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top